US8491908B2ActiveUtilityA1
Composite particle, contrast agent for photoacoustic imaging, and method for producing the composite particle
Est. expiryJun 1, 2030(~3.9 yrs left)· nominal 20-yr term from priority
G01N 33/54313C07K 17/14C07K 17/08G01N 33/533
76
PatentIndex Score
4
Cited by
26
References
8
Claims
Abstract
The present invention provides a composite particle having a high molar absorption coefficient for detection with higher detection sensitivity in photoacoustic imaging. In the present invention, a composite particle having a particle, a single-chain antibody which includes an antigen recognition region and a region other than the antigen recognition region and which is conjugated with the particle, and an organic dye conjugated with the single-chain antibody, in which the region other than the antigen recognition region of the single-chain antibody has thiol group, and a functional group of the particle is bound to the thiol group, is provided.
Claims
exact text as granted — not AI-modifiedWhat is claimed is:
1. A composite particle having
a particle,
a single-chain antibody which includes an antigen recognition region and a region other than the antigen recognition region and which is conjugated with the particle, and
an organic dye conjugated with the single-chain antibody,
wherein the region other than the antigen recognition region of the single-chain antibody has a thiol group, and a functional group of the particle is bound to the thiol group.
2. The composite particle according to claim 1 , wherein the single-chain antibody has at least any one of an amino group, carboxyl group and hydroxyl group, and a functional group of the organic dye is bound to the at least any one of the amino group, carboxyl group and hydroxyl group.
3. The composite particle according to claim 1 , wherein the particle has at least any one of an iron oxide particle and indocyanine green.
4. The composite particle according to claim 1 , wherein the single-chain antibody has an amino acid sequence of SEQ ID NO: 1:
(SEQ ID NO: 1)
MDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKA
PKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYT
TPPTFGQGTKVEIKGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLS
CAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTIS
ADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSA
AALEHHHHHHGGC.
5. A contrast agent for photoacoustic imaging containing the composite particle according to claim 1 and a dispersion medium.
6. A composite particle having
a particle,
a single-chain antibody which includes an antigen recognition region and a region other than the antigen recognition region and which is conjugated with the particle, and
an organic dye conjugated with the single-chain antibody,
wherein the single-chain antibody and the particle are conjugated via a thiol group in the region other than the antigen recognition region of the single-chain antibody.
7. The composite particle according to claim 6 , wherein the single-chain antibody and the organic dye are conjugated via at least any one of amino, hydroxyl and carboxyl groups in the single-chain antibody.
8. A method for producing a composite particle, comprising binding a functional group contained in a particle to a thiol group contained in a region other than an antigen recognition region in a single-chain antibody that includes the antigen recognition region and the region other than the antigen recognition region and binding a functional group of an organic dye to at least any one of amino, carboxyl and hydroxyl groups of the single-chain antibody.Cited by (0)
No later patents cite this yet.
References (0)
No backward citations on record.