US8105603B2ExpiredUtilityA1

Polypeptides that bind APRIL

90
Individually held — no corporate assignee on recordPriority: Jan 29, 2004Filed: Mar 16, 2009Granted: Jan 31, 2012
Est. expiryJan 29, 2024(expired)· nominal 20-yr term from priority
Inventors:Robert F. KelleyDarshana Patel
A61P 37/04A61P 37/06A61P 37/00A61P 43/00A61P 33/02A61P 31/12A61P 29/00A61P 31/04A61P 31/22A61P 33/00A61P 31/10A61P 35/00A61P 31/20A61P 35/02A61P 25/28A61P 31/18A61P 31/14G01N 33/564Y10S930/12G01N 2500/02C07K 14/70578C07K 14/70575A61P 19/02A61K 38/00
90
PatentIndex Score
29
Cited by
202
References
26
Claims

Abstract

The present invention relates to polypeptides that inhibit APRIL and/or BAFF binding to BCMA, nucleic acid molecules encoding the polypeptides, and compositions comprising the polypeptides. The present invention also relates to methods for treating an immune-related disease or cancer using the polypeptides and compositions of the invention. The present invention also relates to methods for identifying inhibitors of APRIL/BAFF binding to BCMA and APRIL/BAFF signaling.

Claims

exact text as granted — not AI-modified
1. An isolated polypeptide that binds APRIL comprising the following sequence:
 C-S-Q-N-E-Y-F-D-S-L X 11 -H-A-C-X 15 -P-C-X 18 -L-X 20 -C-S-S-N-T-P-P-L-T-C-Q-R-Y-C (SEQ ID NO: 34) wherein X 11  is L, I, or V; wherein X 15  is I, A, or K; wherein X 18  is Q or D; and wherein X 20  is R or Y and wherein the sequence does not comprise the sequence 
 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 35) 
                 
                   CSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYC. 
                     
                 
             
                
                
               
            
           
         
       
     
     
       2. The isolated polypeptide according to  claim 1 , wherein if X 20  is Y, then X 18  is D. 
     
     
       3. The isolated polypeptide according to  claim 1 , wherein X 15  is K. 
     
     
       4. The isolated polypeptide according to  claim 1 , wherein X 18  is Q. 
     
     
       5. The isolated polypeptide according to  claim 1 , wherein X 20  is R. 
     
     
       6. The isolated polypeptide according to  claim 1 , wherein the polypeptide comprises an amino acid sequence that is 85% or more identical to a CRD sequence of a native BCMA SEQ ID NO: 35. 
     
     
       7. The isolated polypeptide according to  claim 1 , wherein the sequence is selected from the group consisting of: 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 6) 
                 
                   CSQNEYFDSLLHACKPCQLRCSSNTPPLTCQRYC,  
                     
                 
                     
                 
                     
                   (SEQ ID NO: 7) 
                 
                   CSQNEYFDSLLHACKPCDLRCSSNTPPLTCQRYC, 
                     
                 
                     
                 
                     
                   (SEQ ID NO: 8) 
                 
                   CSQNEYFDSLLHACKPCDLYCSSNTPPLTCQRYC,  
                     
                 
                   and  
                     
                 
                     
                 
                     
                   (SEQ ID NO: 9) 
                 
                   CSQNEYFDSLVHACKPCQLRCSSNTPPLTCQRYC.  
                     
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
       8. The isolated polypeptide according to  claim 1 , wherein the polypeptide further comprises the sequence NSVKGT linked carboxy-terminal to the polypeptide set forth in SEQ ID NO: 34. 
     
     
       9. The isolated polypeptide according to  claim 1 , wherein the polypeptide further comprises a sequence that is heterologous to a native BCMA polypeptide positioned at the N-terminus, C-terminus, or both the N-terminus and C-terminus of the polypeptide. 
     
     
       10. The isolated polypeptide according to  claim 1 , wherein the polypeptide further comprises the Fc domain of an IgG1 protein. 
     
     
       11. The isolated polypeptide according to  claim 10 , wherein the polypeptide comprises the amino acid sequence set forth in SEQ ID NO: 31. 
     
     
       12. The isolated polypeptide according to  claim 1 , wherein the polypeptide further comprises a leucine zipper. 
     
     
       13. The isolated polypeptide according to  claim 1 , wherein the polypeptide is attached to a non-proteinaceous polymer comprising polyethylene glycol. 
     
     
       14. The isolated polypeptide according to  claim 1 , wherein the polypeptide is an antibody. 
     
     
       15. The isolated polypeptide according to  claim 14 , wherein the antibody is selected from the group consisting of a F(ab) antibody, F(ab′)2 antibody, and a scFv antibody. 
     
     
       16. The isolated polypeptide according to  claim 1 , wherein the polypeptide is attached to an agent selected from the group consisting of a growth inhibitory agent, a cytotoxic agent, a detection agent, an agent that improves the bioavailability of the polypeptide, and an agent that improves the half-life of the polypeptide. 
     
     
       17. The isolated polypeptide according to  claim 16 , wherein said cytotoxic agent is selected from the group consisting of a toxin, an antibiotic, and a radioactive isotope. 
     
     
       18. The isolated polypeptide according to  claim 1 , wherein X 11  is L, X 15  is K and X 18  is Q. 
     
     
       19. The isolated polypeptide according to  claim 1 , wherein said polypeptide binds to BCMA with decreased affinity as compared to a native BCMA polypeptide. 
     
     
       20. The isolated polypeptide according to  claim 1 , wherein said polypeptide binds to APRIL with increased affinity as compared to a native BCMA polypeptide. 
     
     
       21. A nucleic acid molecule encoding the polypeptide according to  claim 1 . 
     
     
       22. A vector comprising the nucleic acid molecule according to  claim 21 . 
     
     
       23. A host cell comprising the nucleic acid molecule according to  claim 21  or a vector comprising the nucleic acid molecule. 
     
     
       24. A composition comprising the isolated polypeptide according to  claim 1 , optionally further comprising a pharmaceutically acceptable carrier. 
     
     
       25. A composition comprising the polypeptide according to  claim 1 , optionally further comprising a second therapeutic agent selected from the group consisting of an agent for treating an immune-related disease, a chemotherapeutic agent, and a cytotoxic agent. 
     
     
       26. A method for producing a polypeptide comprising the step of culturing a host cell comprising the vector according to  claim 22  under conditions suitable for expressing the polypeptide from the vector.

Join the waitlist — get patent alerts

Track US8105603B2 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.