Growth hormone fusion proteins, methods of production, and methods of treatment
Abstract
A plasmid encoding a fusion protein comprising a first polypeptide having growth hormone activity and a second polypeptide which may be one of insulin growth factor (IGF)-I or IGF-II and their analogues, chicken histone H2A.I or human transcription factor SPI-lac Z with an optional cleavage sequence between the first and second polypeptides. The fusion protein may be used: 1) to treat growth hormone deficiencies; 2) to suppress loss of body protein following trauma such as burns or infection; 3) for farm animals to increase growth rates and efficiency of food conversion; 4) and to support growth of cells in culture.
Claims
exact text as granted — not AI-modifiedWe claim:
1. A fusion protein exhibiting growth factor activity including: (a) a first amino acid sequence including the first 46 N-terminal amino acids of methionine porcine growth hormone (metpGH) selected from the group consisting of: MFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQVN, and MFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQVNFAHY; and (b) a second amino acid sequence for epidermal growth factor, joined to the C-terminal of the first amino acid sequence.
2. A fusion protein exhibiting insulin-like growth factor-I (IGF-I) or insulin-like growth factor-II (IGF-II) activity including: (a) a first amino acid sequence including the first 11 N-terminal amino acids of metpGH selected from the group consisting of: MFPAMPLSSLF-, MFPAMPLSSLFVN-, MFPAMPLSSLFVNFAHY- and MFPAMPLSSLFVNGFAHY-; and (b) a second amino acid sequence for IGF-I, IGF-II, or analogues thereof, joined to the C-terminal of the first amino acid sequence.
3. A pharmaceutical or veterinary composition for the treatment of growth hormone deficiencies or catabolic conditions in mammals or for increasing growth rates, redistributing nutrients or enhancing food conversion efficiency in mammals, said composition including an effective amount of: (a) a fusion protein exhibiting IGF-I or IGF-II activity including: (i) a first amino acid sequence including the first 11 N-terminal amino acids of metpGH selected from the group consisting of: MFPAMPLSSLF-, MFPAMPLSSLFVN-, MFPAMPLSSLFVNFAHY- and MFPAMPLSSLFVNGFAHY-; and (ii) a second amino acid sequence for IGF-I, IGF-II, or analogues thereof, joined to the C-terminal of the first amino acid sequence; and, (b) a pharmaceutically or veterinarily acceptable diluent, carrier or excipient therefor.
4. A method for the treatment of growth hormone deficiencies or catabolic conditions in mammals including those associated with infant prematurity, growth hormone deficiency, somatomedin deficiency, burns, infection, other trauma, cancer, cystic fibrosis, Duchenne muscular dystrophy, Becker dystrophy, autosomal recessive dystrophy, polymyositis as well as other myopathies, or for increasing growth rates, redistributing nutrients or enhancing food conversion efficiency in mammals, which method includes administering to a patient to be treated an effective amount of a fusion protein exhibiting IGF-I or IGF-II activity including: (a) a first amino acid sequence including the first 11 N-terminal amino acids of metpGH selected from the group consisting of: MFPAMPLSSLF-, MFPAMPLSSLFVN-, MFPAMPLSSLFVNFAHY- and MFPAMPLSSLFVNGFAHY-; and (b) a second amino acid sequence for IGF-I, IGF-II, or analogues thereof, joined to the C-terminal of said first amino acid sequence.
5. A method according to claim 4 wherein the fusion protein is administered at a dose rate of approximately 0.01 to 10 milligrams/kg body weight/day.
6. A method for improving the growth of cells in culture which method includes adding to a culture medium an effective amount of a fusion protein exhibiting IGF-I or IGF-II activity including: (a) a first amino acid sequence including the first 11 N-terminal amino acids of metpGH selected from the group consisting of: MFPAMPLSSLF-, MFPAMPLSSLFVN-, MFPAMPLSSLFVNFAHY- and MFPAMPLSSLFVNGFAHY-; and (b) a second amino acid sequence for IGF-I, IGF-II, or analogues thereof, joined to the C-terminal of said first amino acid sequence.
7. A plasmid encoding a fusion protein exhibiting IGF-I or IGF-II activity, said plasmid including as operatively joined components: (a) a suitable expression vector; (b) a first nucleic acid sequence encoding an amino acid sequence including the first 11 N-terminal amino acids of metpGH selected from the group consisting of: MFPAMPLSSLF-, MFPAMPLSSLFVN-, MFPAMPLSSLFVNFAHY- and MFPAMPLSSLFVNGFAHY-; and (c) a second nucleic acid sequence encoding a polypeptide for IGF-I, IGF-II, or analogues thereof, located 3' to said first nucleic acid sequence.
8. A process for the production of a fusion protein exhibiting IGF-I or IGF-II activity which process includes; (a) introducing into a unicellular organism a plasmid including as operatively joined components; a suitable expression vector containing a first nucleic acid sequence encoding an amino acid sequence including the first 11 N-terminal amino acids of metpGH selected from the group consisting of: MFPAMPLSSLF-, MFPAMPLSSLFVN-, MFPAMPLSSLFVNFAHY- and MFPAMPLSSLFVNGFAHY-; and a second nucleic acid sequence encoding a polypeptide for IGF-I, IGF-II, or analogues thereof, located 34' to said first nucleic acid sequence; (b) culturing the resultant organism; (c) expressing the polypeptide encoded by said DNA sequences; and (d) isolating said polypeptide from the culture.
9. A process according to claim 8 wherein the unicellular organism is an E. coli strain.Join the waitlist — get patent alerts
Track US5330971A — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.