US2026034200A1PendingUtilityA1
Tolerogenic peptides
Est. expiryJul 27, 2042(~16 yrs left)· nominal 20-yr term from priority
C12Y 401/01015C12N 9/88A61P 37/06A61P 3/10A61K 39/0008A61K 38/51
63
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present disclosure is based in part on studies on novel tolerogenic peptides derived from a protein expressed by a pancreatic cell, which have been developed for use in antigen-specific immunotherapy for type 1 diabetes. Disclosed is a tolerogenic peptide capable of binding an MHC class II molecule independent of antigen processing for use in the treatment of type 1 diabetes, wherein the peptide is derived from a protein expressed by a pancreatic cell.
Claims
exact text as granted — not AI-modified1 . A method of treating type-1 diabetes, the method comprising administering to a subject in need thereof a tolerogenic peptide capable of binding an MHC class II molecule independent of antigen processing for use in the treatment of type 1 diabetes, wherein the peptide comprises a fragment of glutamate decarboxylase 65 (GAD65) or a variant thereof.
2 . (canceled)
3 . The method according to claim 1 , wherein the fragment of GAD65 comprises 5 to 40, 5 to 20, or 5 to 15 amino acids in length.
4 . (canceled)
5 . The method according to claim 1 , wherein the peptide is selected from SEQ ID NO: 20 to 23.
6 . (canceled)
7 . The method according to claim 1 , wherein the peptide comprises the amino acid sequence DAAWGGGLLMSRKHKWKLSGVERANSVTWN, IFSPGGAISNMYAMMIARFKMFPEVKEKGMA, DLERRILEAKQKGFVPFLVSATAGTTVYGA, or fragment thereof.
8 .- 9 . (canceled)
10 . The method according to claim 7 , wherein the peptide comprises one or more amino acid modifications selected from:
(i) one or more amino acid substitutions (including conservative substitutions), (ii) one or more amino acid deletions, (iii) one or more amino acid additions and/or (iv) one or more sequence inversions.
11 . The method according to claim 10 , wherein the peptide is selected from SEQ ID NO: 1 to 65, or SEQ ID NO:1 to 23.
12 . (canceled)
13 . The tolerogenic peptide for use according to claim 1 , wherein the peptide further comprises one or more amino acid modifications that increase the solubility of the peptide.
14 . The tolerogenic peptide for use according to claim 13 , wherein the one or more amino acid modifications comprise addition and/or substitution of a wild-type or reference residue with one or more amino acids selected from lysine, arginine, histidine, aspartic acid, glutamic acid, serine, threonine, asparagine and/or glutamine.
15 . The tolerogenic peptide for use according to claim 13 , wherein the one or more amino acid modifications comprise addition of one to four lysine residues to the N-terminus and/or C-terminus of the peptide.
16 . The tolerogenic peptide for use according to claim 15 , wherein the peptide is selected from KKKWKLSGVERKKK, KKKWKLSGVERAKKK, KKKRISNMYAMMIARRKKK, KKKKISNMYAMMIARKKKK and/or KKERRILEAKQKGFVPKK.
17 . (canceled)
18 . A pharmaceutical composition comprising an effective amount of one or more tolerogenic peptides selected from SEQ ID NO: 1 to 65; and optionally, wherein the peptide further comprises one or more amino acid modifications that increase the solubility of the peptide.
19 .- 20 . (canceled)
21 . A tolerogenic peptide capable of binding an MHC class II molecule independent of antigen processing, wherein the peptide derived from a pancreatic cell comprises a fragment of glutamate decarboxylase 65 (GAD65) and comprises the sequence WKLSGVER, ISNMYAMMIA or ERRILEAKOKGFVP.
22 .- 29 . (canceled)
30 . The tolerogenic peptide according to claim 21 , wherein the peptide is selected from SEQ ID NO: 1 to 65.
31 . The tolerogenic peptide according to claim 30 , wherein the peptide further comprises one or more amino acid modifications that increase the solubility of the peptide.
32 . The tolerogenic peptide according to claim 31 , wherein the one or more amino acid modifications comprise addition and/or substitution of a wild-type or reference residue with one or more amino acids selected from lysine, arginine, histidine, aspartic acid, glutamic acid, serine, threonine, asparagine and/or glutamine.
33 . The tolerogenic peptide according to claim 31 , wherein the one or more amino acid modifications comprise addition of one to four lysine residues to the N-terminus and/or C-terminus of the peptide.
34 . The tolerogenic peptide according to claim 33 , wherein the peptide is selected from KKKWKLSGVERKKK, KKKWKLSGVERAKKK, KKKRISNMYAMMIARRKKK, KKKKISNMYAMMIARKKKK and/or KKERRILEAKQKGFVPKK.
35 . A pharmaceutical composition comprising an effective amount of tolerogenic peptide according to claim 21 .
36 . (canceled)
37 . The tolerogenic peptide according to claim 21 , wherein the peptide further comprises labelling with one or more moieties selected from: radionuclide, peptide tag, luminescent molecule, fluorescent molecule, quencher molecule, pH sensitive molecule, oxygen sensitive molecule or a combination thereof.Join the waitlist — get patent alerts
Track US2026034200A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.