US2026034200A1PendingUtilityA1

Tolerogenic peptides

Assignee: UNIV BIRMINGHAMPriority: Jul 27, 2022Filed: Jul 27, 2023Published: Feb 5, 2026
Est. expiryJul 27, 2042(~16 yrs left)· nominal 20-yr term from priority
C12Y 401/01015C12N 9/88A61P 37/06A61P 3/10A61K 39/0008A61K 38/51
63
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The present disclosure is based in part on studies on novel tolerogenic peptides derived from a protein expressed by a pancreatic cell, which have been developed for use in antigen-specific immunotherapy for type 1 diabetes. Disclosed is a tolerogenic peptide capable of binding an MHC class II molecule independent of antigen processing for use in the treatment of type 1 diabetes, wherein the peptide is derived from a protein expressed by a pancreatic cell.

Claims

exact text as granted — not AI-modified
1 . A method of treating type-1 diabetes, the method comprising administering to a subject in need thereof a tolerogenic peptide capable of binding an MHC class II molecule independent of antigen processing for use in the treatment of type 1 diabetes, wherein the peptide comprises a fragment of glutamate decarboxylase 65 (GAD65) or a variant thereof. 
     
     
         2 . (canceled) 
     
     
         3 . The method according to  claim 1 , wherein the fragment of GAD65 comprises 5 to 40, 5 to 20, or 5 to 15 amino acids in length. 
     
     
         4 . (canceled) 
     
     
         5 . The method according to  claim 1 , wherein the peptide is selected from SEQ ID NO: 20 to 23. 
     
     
         6 . (canceled) 
     
     
         7 . The method according to  claim 1 , wherein the peptide comprises the amino acid sequence DAAWGGGLLMSRKHKWKLSGVERANSVTWN, IFSPGGAISNMYAMMIARFKMFPEVKEKGMA, DLERRILEAKQKGFVPFLVSATAGTTVYGA, or fragment thereof. 
     
     
         8 .- 9 . (canceled) 
     
     
         10 . The method according to  claim 7 , wherein the peptide comprises one or more amino acid modifications selected from:
 (i) one or more amino acid substitutions (including conservative substitutions),   (ii) one or more amino acid deletions,   (iii) one or more amino acid additions and/or   (iv) one or more sequence inversions.   
     
     
         11 . The method according to  claim 10 , wherein the peptide is selected from SEQ ID NO: 1 to 65, or SEQ ID NO:1 to 23. 
     
     
         12 . (canceled) 
     
     
         13 . The tolerogenic peptide for use according to  claim 1 , wherein the peptide further comprises one or more amino acid modifications that increase the solubility of the peptide. 
     
     
         14 . The tolerogenic peptide for use according to  claim 13 , wherein the one or more amino acid modifications comprise addition and/or substitution of a wild-type or reference residue with one or more amino acids selected from lysine, arginine, histidine, aspartic acid, glutamic acid, serine, threonine, asparagine and/or glutamine. 
     
     
         15 . The tolerogenic peptide for use according to  claim 13 , wherein the one or more amino acid modifications comprise addition of one to four lysine residues to the N-terminus and/or C-terminus of the peptide. 
     
     
         16 . The tolerogenic peptide for use according to  claim 15 , wherein the peptide is selected from KKKWKLSGVERKKK, KKKWKLSGVERAKKK, KKKRISNMYAMMIARRKKK, KKKKISNMYAMMIARKKKK and/or KKERRILEAKQKGFVPKK. 
     
     
         17 . (canceled) 
     
     
         18 . A pharmaceutical composition comprising an effective amount of one or more tolerogenic peptides selected from SEQ ID NO: 1 to 65; and optionally, wherein the peptide further comprises one or more amino acid modifications that increase the solubility of the peptide. 
     
     
         19 .- 20 . (canceled) 
     
     
         21 . A tolerogenic peptide capable of binding an MHC class II molecule independent of antigen processing, wherein the peptide derived from a pancreatic cell comprises a fragment of glutamate decarboxylase 65 (GAD65) and comprises the sequence WKLSGVER, ISNMYAMMIA or ERRILEAKOKGFVP. 
     
     
         22 .- 29 . (canceled) 
     
     
         30 . The tolerogenic peptide according to  claim 21 , wherein the peptide is selected from SEQ ID NO: 1 to 65. 
     
     
         31 . The tolerogenic peptide according to  claim 30 , wherein the peptide further comprises one or more amino acid modifications that increase the solubility of the peptide. 
     
     
         32 . The tolerogenic peptide according to  claim 31 , wherein the one or more amino acid modifications comprise addition and/or substitution of a wild-type or reference residue with one or more amino acids selected from lysine, arginine, histidine, aspartic acid, glutamic acid, serine, threonine, asparagine and/or glutamine. 
     
     
         33 . The tolerogenic peptide according to  claim 31 , wherein the one or more amino acid modifications comprise addition of one to four lysine residues to the N-terminus and/or C-terminus of the peptide. 
     
     
         34 . The tolerogenic peptide according to  claim 33 , wherein the peptide is selected from KKKWKLSGVERKKK, KKKWKLSGVERAKKK, KKKRISNMYAMMIARRKKK, KKKKISNMYAMMIARKKKK and/or KKERRILEAKQKGFVPKK. 
     
     
         35 . A pharmaceutical composition comprising an effective amount of tolerogenic peptide according to  claim 21 . 
     
     
         36 . (canceled) 
     
     
         37 . The tolerogenic peptide according to  claim 21 , wherein the peptide further comprises labelling with one or more moieties selected from: radionuclide, peptide tag, luminescent molecule, fluorescent molecule, quencher molecule, pH sensitive molecule, oxygen sensitive molecule or a combination thereof.

Join the waitlist — get patent alerts

Track US2026034200A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.