US2023141371A1PendingUtilityA1

Coronavirus vaccines and methods of use

Assignee: BIONTECH US INCPriority: Mar 20, 2020Filed: Mar 19, 2021Published: May 11, 2023
Est. expiryMar 20, 2040(~13.6 yrs left)· nominal 20-yr term from priority
A61K 40/46A61K 40/11A61K 2039/53A61K 2039/545A61K 39/12A61P 37/04A61P 31/14A61K 2039/70C07K 14/005C12N 2770/20034A61K 2039/6056C12N 2770/20071A61K 39/215A61K 2039/6018A61K 2039/51A61K 2039/572A61K 2039/6031A61P 11/00C12N 2770/20022A61K 2039/57C12N 7/00C07K 2319/03A61K 2039/5154A61K 2039/575
48
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

Compositions and methods for the prevention and/or treatment of a viral infection, in particular of the Coronaviridae family.

Claims

exact text as granted — not AI-modified
What is claimed is: 
     
         1 . A composition comprising:
 (i) a polypeptide comprising at least two of the following (a) a sequence comprising an epitope sequence from ORF1ab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N);   (ii) a polynucleotide encoding a polypeptide, wherein the polypeptide comprises at least two of the following (a) a sequence comprising an epitope sequence from ORF1ab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N);   (iii) a T cell receptor (TCR) or a T cell comprising the TCR, wherein the TCR binds to an epitope sequence of the polypeptide in complex with a corresponding HLA class I or class II molecule;   (iv) an antigen presenting cell comprising (i) or (ii); or   (v) an antibody or B cell comprising the antibody, wherein the antibody binds to an epitope sequence of the polypeptide; and   a pharmaceutically acceptable excipient.   
     
     
         2 . The composition of  claim 1 , wherein the polypeptide comprises (a) a sequence comprising an epitope sequence from ORF1ab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N). 
     
     
         3 . The composition of  claim 1 , wherein the sequence comprising an epitope sequence from ORF1ab is C-terminal to the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N). 
     
     
         4 . The composition of  claim 1 , wherein the sequence comprising an epitope sequence from ORF1ab is N-terminal to the sequence comprising an epitope sequence from membrane glycoprotein (M). 
     
     
         5 . The composition of  claim 1 , wherein the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N) is N-terminal to the sequence comprising an epitope sequence from membrane glycoprotein (M). 
     
     
         6 . The composition of  claim 1 , wherein the polypeptide comprises (a) 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more epitope sequences from ORF1ab, (b) a sequence comprising an epitope sequence from membrane glycoprotein (M) and (c) a sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N). 
     
     
         7 . The composition of  claim 1 , wherein the epitope sequence from ORF1ab is an epitope sequence from a non-structural protein (NSP). 
     
     
         8 . The composition of  claim 7 , wherein the non-structural protein (NSP) is selected from the group consisting of NSP1, NSP2, NSP3, NSP4 and combinations thereof. 
     
     
         9 . The composition of  claim 1 , wherein the polypeptide comprises a sequence comprising an epitope sequence from NSP1, a sequence comprising an epitope sequence from NSP2, a sequence comprising an epitope sequence from NSP3 and a sequence comprising an epitope sequence from NSP4. 
     
     
         10 . The composition of  claim 1 , wherein the epitope sequence from ORF1ab is selected from the group consisting of YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK and any combination thereof. 
     
     
         11 . The composition of  claim 1 , wherein the epitope sequence from nucleocapsid glycoprotein (N) is LLLDRLNQL. 
     
     
         12 . The composition of  claim 1 , wherein the epitope sequence from membrane phosphoprotein (M) is VATSRTLSY. 
     
     
         13 . The composition of  claim 1 , wherein the polypeptide comprises an epitope sequence from nucleocapsid glycoprotein (N) that is LLLDRLNQL and an epitope sequence from membrane phosphoprotein (M) that is VATSRTLSY. 
     
     
         14 . The composition of  claim 1 , wherein the polypeptide comprises (a) each of the following epitope sequences from ORF1ab: YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, KTIQPRVEK; (b) an epitope sequence from nucleocapsid glycoprotein (N) that is LLLDRLNQL; and (c) an epitope sequence from membrane phosphoprotein (M) that is VATSRTLSY. 
     
     
         15 . The composition of  claim 1 , wherein the sequence comprising an epitope sequence from ORF1ab is selected from the group consisting of the following sequences or fragments thereof:
 MVTNNTFTLKVPHVGEIPVAYRKVLLKTIQPRVEKYLFDESGEFKLSEVGPEHSLAEYYIFF ASFYY;   MVTNNTFTLKVPHVGEIPVAYRKVLLKTIQPRVEKYLFDESGEFKLSEVGPEHSLAEY;   APKEIIFLEGETLFGDDTVIEVAIILASFSAST;   APKEIIFLEGETLFGDDTVIEV;   HTTDPSFLGRYMSALFADDLNQLTGYHTDFSSEIIGYQLMCQPILLAEAELAKNVSLILGTV SWNL;   TTDPSFLGRYMSALFADDLNQLTGYHTDFSSEIIGYQLMCQPILLAEAELAKNVSLILGTVS WNL;   LLSAGIFGAITDVFYKENSYKVPTDNYITTY; and combinations thereof.   
     
     
         16 . The composition of  claim 1 , wherein the sequence comprising an epitope sequence from membrane glycoprotein (M) is selected from the group consisting of the following sequences or fragments thereof:
 ADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLA CFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPL HGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRV AGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ;   FAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFI ASFRLF;   LGRCDIKDLPKEITVATSRTLSYYKLGASQRVA;   KLLEQWNLVIGF;   NRNRFLYIIKLIFLWLLWPVTLACFVLAAVY;   SELVIGAVILRGHLRIAGHHLGR;   VATSRTLSYYKLGASQRV;   GLMWLSYF; and combinations thereof.   
     
     
         17 . The composition of  claim 1 , wherein the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N) is selected from the group consisting of the following sequences or fragments thereof:
 KDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQL PQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALL LLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPE QTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLD DKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADL DDFSKQLQQSMSSADSTQA;   RMAGNGGDAALALLLLDRLNQLESKMSGKGQQQ;   YKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHID AYKTFP;   SPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRT ATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGME VTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDK and combinations thereof.   
     
     
         18 . The composition of  claim 1 , wherein the polypeptide comprises one or more linker sequences. 
     
     
         19 . The composition of  claim 18 , wherein the one or more linker sequences are selected from the group consisting of GGSGGGGSGG, GGSLGGGGSG. 
     
     
         20 . The composition of  claim 18 , wherein the one or more linker sequences comprise cleavage sequences. 
     
     
         21 . The composition of  claim 20 , wherein the one or more cleavage sequences are selected from the group consisting of FRAC, KRCF, KKRY, ARMA, RRSG, MRAC, KMCG, ARCA, KKQG, YRSY, SFMN, FKAA, KRNG, YNSF, KKNG, RRRG, KRYS, and ARYA. 
     
     
         22 . The composition of  claim 1 , wherein the polypeptide comprises a transmembrane domain sequence. 
     
     
         23 . The composition of  claim 22 , wherein the transmembrane domain sequence is C-terminal to the sequence comprising an epitope sequence from ORF1ab, the sequence comprising an epitope sequence from membrane glycoprotein (M) and the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N). 
     
     
         24 . The composition of  claim 22 , wherein the transmembrane domain sequence is 
       
         
           
                 
                 
               
                     
                   EQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCL 
                 
                     
                     
                 
                     
                   VKGCCSCGSCCKFDEDDSEPVLKGKLHYT. 
                 
             
                
                
                
               
            
           
         
       
     
     
         25 . The composition of  claim 1 , wherein the polypeptide comprises an SEC sequence. 
     
     
         26 . The composition of  claim 25 , wherein the SEC sequence is N-terminal to the sequence comprising an epitope sequence from ORF1ab, the sequence comprising an epitope sequence from membrane glycoprotein (M) and the sequence comprising an epitope sequence from nucleocapsid phosphoprotein (N). 
     
     
         27 . The composition of  claim 25 , wherein the SEC sequence is MFVFLVLLPLVSSQCVNLT. 
     
     
         28 . The composition of  claim 1 , wherein the composition comprises the polynucleotide encoding the polypeptide. 
     
     
         29 . The composition of  claim 28 , wherein the polynucleotide is an mRNA. 
     
     
         30 . The composition of  claim 28 , wherein the polynucleotide comprises a codon optimized sequence for expression in a human. 
     
     
         31 . The composition of  claim 28 , wherein the polynucleotide comprises a dEarI-hAg sequence. 
     
     
         32 . The composition of  claim 31 , wherein the dEarI-hAg sequence is ATTCTTCTGGTCCCCACAGACTCAGAGAGAACCC, optionally wherein each T is a U. 
     
     
         33 . The composition of  claim 28 , wherein the polynucleotide comprises a Kozak sequence. 
     
     
         34 . The composition of  claim 33 , wherein the a Kozak sequences is GCCACC. 
     
     
         35 . The composition of  claim 28 , wherein the polynucleotide comprises an F element sequence. 
     
     
         36 . The composition of  claim 35 , wherein the F element sequence is a 3 UTR of amino-terminal enhancer of split (AES). 
     
     
         37 . The composition of  claim 35 , wherein the F element sequence is CTGGTACTGCATGCACGCAATGCTAGCTGCCCCTTTCCCGTCCTGGGTACCCCGAGTCT CCCCCGACCTCGGGTCCCAGGTATGCTCCCACCTCCACCTGCCCCACTCACCACCTCTG CTAGTTCCAGACACCTCC, optionally wherein each T is a U. 
     
     
         38 . The composition of  claim 28 , wherein the polynucleotide comprises an I element sequence. 
     
     
         39 . The composition of  claim 38 , wherein the I element sequence is a 3′ UTR of mitochondrially encoded 12S rRNA (mtRNR1). 
     
     
         40 . The composition of  claim 38 , wherein the I element sequence is CAAGCACGCAGCAATGCAGCTCAAAACGCTTAGCCTAGCCACACCCCCACGGGAAAC AGCAGTGATTAACCTTTAGCAATAAACGAAAGTTTAACTAAGCTATACTAACCCCAGG GTTGGTCAATTTCGTGCCAGCCACACC, optionally wherein each T is a U. 
     
     
         41 . The composition of  claim 28 , wherein the polynucleotide comprises a poly A sequence. 
     
     
         42 . The composition of  claim 41 , wherein the poly A sequence is AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGCATATGACTAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA, optionally wherein each T is a U. 
     
     
         43 . The composition of  claim 1 , wherein each of the epitope sequences from the ORF1ab, the membrane glycoprotein, and the nucleocapsid phosphoprotein are from 2019 SARS-CoV-2. 
     
     
         44 . The composition of  claim 1 , wherein one or more or each epitope elicits a T cell response. 
     
     
         45 . The composition of  claim 1 , wherein one or more or each epitope has been observed by mass spectrometry as being presented by an HLA molecule. 
     
     
         46 . The composition of  claim 1 , wherein the composition comprises (i) a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS C1p1full, RS C2p1full, RS C3p1full, RS C4p1full, RS C5p1, RS C5p2, RS C5p2full, RS C6p1, RS C6p2, RS C6p2full, RS C7p1, RS C7p2, RS C7p2full, RS C8p1, RS C8p2 and RS C8p2full; (ii) a polynucleotide encoding a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS C1p1full, RS C2p1full, RS C3p1full, RS C4p1full, RS C5p1, RS C5p2, RS C5p2full, RS C6p1, RS C6p2, RS C6p2full, RS C7p1, RS C7p2, RS C7p2full, RS C8p1, RS C8p2 and RS C8p2full; or (iii) a polynucleotide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: RS C1n1, RS C2n1, RS C3n1, RS C4n1, RS C5n1, RS C6n1, RS C7n1, RS C8n1, RS C5n2, RS C6n2, RS C7n2, RS C8n2, RS C5n2full, RS C6n2full, RS C7n2full and RS C8n2full. 
     
     
         47 . A pharmaceutical composition comprising the composition of any one of  claims 1 - 46 . 
     
     
         48 . A pharmaceutical composition comprising:
 (i) a polypeptide comprising an epitope sequence of Table 1A, Table 1B, Table 1C, Table 2Ai, Table 2Aii, Table 2B and/or Table 16;   (ii) a polynucleotide encoding the polypeptide comprising an epitope sequence of Table 1A, Table 1B, Table 1C, Table 2Ai, Table 2Aii, Table 2B and/or Table 16;   (iii) a T cell receptor (TCR) or a T cell comprising the TCR, wherein the TCR binds to the epitope sequence in complex with a corresponding HLA class I or class II molecule;   (iv) an antigen presenting cell comprising (i) or (ii); or   (v) an antibody or B cell comprising the antibody, wherein the antibody binds to the epitope sequence; and   a pharmaceutically acceptable excipient.   
     
     
         49 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence comprises one or more or each of the following: YLFDESGEFKL, YLFDESGEF, FGDDTVIEV, LLLDRLNQL, QLMCQPILL, TTDPSFLGRY, PTDNYITTY, PSFLGRY, AEAELAKNV, VATSRTLSY and KTIQPRVEK. 
     
     
         50 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence comprises one or more or each of the following: SAPPAQYEL, AVASKILGL, EYADVFHLY, DEFTPFDVV, VRIQPGQTF, SFRLFARTR, KFLPFQQF, VVQEGVLTA, RLDKVEAEV, FGADPIHSL, NYNYLYRLF, KYIKWPWYI, KWPWYIWLGF, LPFNDGVYF, QPTESIVRF, IPFAMQMAY, YLQPRTFLL and RLQSLQTYV. 
     
     
         51 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an orf1ab protein. 
     
     
         52 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an orf1a protein 
     
     
         53 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from a surface glycoprotein (S) or a shifted reading frame thereof. 
     
     
         54 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from a nucleocapsid phosphoprotein (N). 
     
     
         55 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF3a protein. 
     
     
         56 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from a membrane glycoprotein (M). 
     
     
         57 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF7a protein. 
     
     
         58 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF8 protein. 
     
     
         59 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an envelope protein (E). 
     
     
         60 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF6 protein. 
     
     
         61 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF7b protein. 
     
     
         62 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF10 protein. 
     
     
         63 . The pharmaceutical composition of  claim 48 , wherein the epitope sequence is from an ORF9b protein. 
     
     
         64 . A pharmaceutical composition comprising: a polypeptide having an amino acid sequence with at least 70%, 80%, 90% or 100% sequence identity to a sequence of any one of the sequences depicted in column 2 of Table 11, column 2 of Table 12 or column 3 of Table 15; or a recombinant polynucleotide encoding a polypeptide having an amino acid sequence with at least 70%, 80%, 90% or 100% sequence identity to a sequence of any one of the sequences depicted in column 2 of Table 11, column 2 of Table 12 or column 3 of Table 15. 
     
     
         65 . The pharmaceutical composition of  claim 64 , wherein the pharmaceutical composition comprises a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS C1p1full, RS C2p1full, RS C3p1full, RS C4p1full, RS C5p1, RS C5p2, RS C5p2full, RS C6p1, RS C6p2, RS C6p2full, RS C7p1, RS C7p2, RS C7p2full, RS C8p1, RS C8p2 and RS C8p2full; or a polynucleotide encoding a polypeptide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of RS C1p1full, RS C2p1full, RS C3p1full, RS C4p1full, RS C5p1, RS C5p2, RS C5p2full, RS C6p1, RS C6p2, RS C6p2full, RS C7p1, RS C7p2, RS C7p2full, RS C8p1, RS C8p2 and RS C8p2full. 
     
     
         66 . The pharmaceutical composition of  claim 64 , wherein the pharmaceutical composition comprises a polynucleotide with at least 70%, 80%, 90% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: RS C1n1, RS C2n1, RS C3n1, RS C4n1, RS C5n1, RS C6n1, RS C7n1, RS C8n1, RS C5n2, RS C6n2, RS C7n2, RS C8n2, RS C5n2full, RS C6n2full, RS C7n2full and RS C8n2full. 
     
     
         67 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the polynucleotide is an mRNA. 
     
     
         68 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , further comprising one or more lipid components. 
     
     
         69 . The pharmaceutical composition of  claim 68 , wherein the one or more lipids comprise a lipid nanoparticle (LNP). 
     
     
         70 . The pharmaceutical composition of  claim 69 , wherein the LNP encapsulates the recombinant polynucleotide construct. 
     
     
         71 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the polypeptide is synthetic. 
     
     
         72 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the polypeptide is recombinant. 
     
     
         73 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the polypeptide is from 8-1000 amino acids in length. 
     
     
         74 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the epitope sequence binds to or is predicted to bind to an HLA class I or class II molecule with a K D  of 1000 nM or less. 
     
     
         75 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the epitope sequence binds to or is predicted to bind to an HLA class I or class II molecule with a K D  of 500 nM or less. 
     
     
         76 . The pharmaceutical composition of any one of the  claims 47 ,  48  or  64 , wherein the epitope sequence comprises a sequence of a viral protein expressed by a virus-infected cell of a subject. 
     
     
         77 . The pharmaceutical composition of  claim 76 , wherein the virus is 2019 SARS-CoV 2. 
     
     
         78 . A method of treating or preventing a infection by a virus or treating a respiratory disease or condition associated with an infection by a virus comprising administering to a subject in need thereof the pharmaceutical composition of any one of the  claims 47 ,  48  or  64 . 
     
     
         79 . The method of  claim 78 , wherein the virus is a coronavirus. 
     
     
         80 . The method of  claim 78 , wherein the virus is 2019 SARS-CoV 2. 
     
     
         81 . The method of  claim 78 , wherein an HLA molecule expressed by the subject is unknown at the time of administration. 
     
     
         82 . The method of  claim 78 , wherein the ability of the virus to avoid escape of recognition by an immune system of the subject is less compared to the ability of the virus to avoid escape of recognition by an immune system of a subject administered a pharmaceutical composition containing an epitope from a single protein or epitopes from fewer proteins than in the pharmaceutical composition of any one of the  claims 47 ,  48  or  64 . 
     
     
         83 . The method of  claim 78 , wherein the subject expresses an HLA molecule encoded by an HLA allele of any one of Table 1A, Table 1B, Table 1C, Table 2Ai, Table 2Aii, Table 2B and Table 16 and the epitope sequence is an HLA allele-matched epitope sequence. 
     
     
         84 . The method of  claim 78 , wherein the epitope sequence comprises one or more or each of the following: SAPPAQYEL, AVASKILGL, EYADVFHLY, DEFTPFDVV, VRIQPGQTF, SFRLFARTR, KFLPFQQF, VVQEGVLTA, RLDKVEAEV and FGADPIHSL. 
     
     
         85 . A method of treating or preventing a 2019 SARS-CoV 2 infection in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of any one of the  claims 47 ,  48  or  64 . 
     
     
         86 . The method of  claim 85 , wherein the pharmaceutical composition is administered in addition to one or more therapeutics for the 2019 SARS-CoV 2 viral infection in the subject. 
     
     
         87 . The method of  claim 85 , wherein the pharmaceutical composition is administered in combination with (a) a polypeptide having an amino acid sequence of a 2019 SARS-CoV 2 spike protein or fragment thereof; (b) a recombinant polynucleotide encoding a 2019 SARS-CoV 2 spike protein or fragment thereof; or a 2019 SARS-CoV 2 spike protein pharmaceutical composition comprising (a) or (b). 
     
     
         88 . The method of  claim 85 , wherein the 2019 SARS-CoV 2 spike protein or fragment thereof is a SARS-CoV-2 spike protein or a fragment thereof. 
     
     
         89 . The method of  claim 85 , wherein the pharmaceutical composition is administered 1-10 weeks after a first administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. 
     
     
         90 . The method of  claim 85 , wherein the pharmaceutical composition is administered 1-6 weeks, 1-6 months or 1-2 years or later after a first administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. 
     
     
         91 . The method of  claim 85 , wherein the pharmaceutical composition is administered on the same day or simultaneously with an administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. 
     
     
         92 . The method of  claim 91 , wherein the pharmaceutical composition is co-formulated with the polypeptide having an amino acid sequence of a 2019 SARS-CoV 2 spike protein or fragment thereof or the recombinant polynucleotide encoding a 2019 SARS-CoV 2 spike protein or fragment thereof. 
     
     
         93 . The method of  claim 85 , wherein the pharmaceutical composition is administered before an administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition, such as 2-10 weeks before an administration of the 2019 SARS-CoV 2 spike protein pharmaceutical composition. 
     
     
         94 . The method of  claim 85 , wherein the pharmaceutical composition is administered prophylactically. 
     
     
         95 . The method of  claim 85 , wherein the pharmaceutical composition is administered once every 1, 2, 3, 4, 5, 6 or more weeks; or once every 1-7, 7-14, 14-21, 21-28, or 28-35 days; or once every 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 days. 
     
     
         96 . Use of the composition of any one of the  claims 1 - 46  for preparing a therapeutic for treating or preventing a respiratory viral infection caused by 2019 SARS CoV-2 virus. 
     
     
         97 . A composition according to any one of  claims 1 - 46  or a pharmaceutical composition according to any one of  claims 47 ,  48  and  64  for use as a medicament. 
     
     
         98 . A composition according to any one of  claims 1 - 46  or a pharmaceutical composition according to any one of  claims 47 ,  48  and  64  for use in the treatment or prevention of a respiratory viral infection caused by 2019 SARS CoV-2 virus.

Join the waitlist — get patent alerts

Track US2023141371A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.