A peptide used for immunotherapeutics
Abstract
Provided is a peptide provided herein includes at least one peptide unit, and the peptide unit may include at least one B-cell epitope, at least one Th epitope, and an appropriate number of auxiliary parts. The peptide unit is a portion designed to uniformly induce only the intended antibody while exhibiting a certain level of immunogenicity in the body of a subject. In addition, the peptide unit is designed with a relatively short length, and thus has the characteristics of easy synthesis and a low production cost. The peptide has properties suitable for use as an immunotherapeutic due to the characteristics of the peptide unit described above. In the present specification, the design principles of the peptide and the peptide unit are disclosed in detail.
Claims
exact text as granted — not AI-modified1 - 25 . (canceled)
26 . A method for treating obesity comprising administering a peptide to a subject,
wherein the peptide is represented by [Formula 1]:
N-B-A 1 -T-A 2 -C; [Formula 1]
wherein, B is a sequence of B-cell epitope for Apolipoprotein B-100, wherein the sequence of B-cell epitope for Apolipoprotein B-100 is at least 90% identical to a sequence selected from RNVPPIFNDVYWIAF (SEQ ID NO: 6), CRFRGLISLSQVYLS (SEQ ID NO: 7), and KTTKQSFDLSVKAQYKKNKH (SEQ ID NO: 8); wherein A 1 is a sequence of first auxiliary part selected from Za and Z, or is absent; wherein T is a sequence of Helper-T-cell epitope (Th epitope), wherein the sequence of Th epitope is at least 90% identical to a sequence selected from K(Cha)VAAWTLKAA (SEQ ID NO: 1), PKYVKQNTLKLAT (SEQ ID NO: 2), ILMQYIKANSKFIGI (SEQ ID NO: 3), QSIALSSLMVAQAIP (SEQ ID NO: 4), ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ (SEQ ID NO: 5), PLGFFPDHQL (SEQ ID NO: 162), WPEANQVGAGAFGPGF (SEQ ID NO: 163), MQWNSTALHQALQDP (SEQ ID NO: 164), MQWNSTTFHQTLQDPRVRGLYFPAGG (SEQ ID NO: 165), FFLLTRILTI (SEQ ID NO: 166), FFLLTRILTIPQSLD (SEQ ID NO: 167), TSLNFLGGTTVCLGQ (SEQ ID NO: 168), QSPTSNHSPTSCPPIC (SEQ ID NO: 169), IIFLFILLLCLIFLLVLLD (SEQ ID NO: 170), CTTPAQGNSMFPSC (SEQ ID NO: 171), CTKPTDGN (SEQ ID NO: 172), WASVRFSW (SEQ ID NO: 173), LLPIFFCLW (SEQ ID NO: 174), MDIDPYKEFGATVELLSFLP (SEQ ID NO: 175), FLPSDFFPSV (SEQ ID NO: 176), RDLLDTASALYREALESPEH (SEQ ID NO: 177), PHHTALRQAILCWGELMTLA (SEQ ID NO: 178), GRETVIEYLVSFGVW (SEQ ID NO: 179), EYLVSFGVWIRTPPA (SEQ ID NO: 180), VSFGVWIRTPPAYRPPNAPI (SEQ ID NO: 181), TVVRRRGRSP (SEQ ID NO: 182), VGPLTVNEKRRLKLI (SEQ ID NO: 183), RHYLHTLWKAGILYK (SEQ ID NO: 184), ESRLVVDFSQFSRGN (SEQ ID NO: 185), LQSLTNLLSSNLSWL (SEQ ID NO: 186), SSNLSWLSLDVSAAF (SEQ ID NO: 187), LHLYSHPIILGFRKI (SEQ ID NO: 188), KQCFRKLPVNRPIDW (SEQ ID NO: 189), LCQVFADATPTGWGL (SEQ ID NO: 190), AANWILRGTSFVYVP (SEQ ID NO: 191), and EIRLKVFVLGGCRHK (SEQ ID NO: 192), wherein A denotes D-form alanine, (Cha) denotes L-cyclohexylalanine, and the Z denotes 6-aminohexanoic acid; wherein A 2 is a sequence of second auxiliary part selected from Z, CR, HHHHHH (SEQ ID NO: 53), and ZGSHHHHHHGSDDDDK (SEQ ID NO: 194), or is absent; wherein the peptide length is 23mer to 71mer; and wherein the peptide is recognized by CD4+ T-cell to induce a humoral immune response.
27 . The method of claim 26 , wherein A1 of the peptide is Za, A2 of the peptide is aZGSHHHHHHGSDDDDK (SEQ ID NO: 194), and the B of the peptide is KTTKQSFDLSVKAQYKKNKH (SEQ ID NO: 8).
28 . The method of claim 27 , wherein the peptide is RNVPPIFNDVYWIAFZaK(Cha)VAAWTLKAAaZGSHHHHHHGSDDDDK (SEQ ID NO: 68).
29 . The method of claim 26 , wherein A 1 of the peptide is Za, A 2 of the peptide is aZ, and B of the peptide is RNVPPIFNDVYWIAF (SEQ ID NO: 6).
30 . The method of claim 29 , wherein the peptide is RNVPPIFNDVYWIAFZaK(Cha)VAAWTLKAAaZ (SEQ ID NO: 56).
31 . The method of claim 26 , wherein A 1 of the peptide is absent, A 2 of the peptide is HHHHHH (SEQ ID NO; 53), and B of the peptide is RNVPPIFNDVYWIAF (SEQ ID NO: 6).
32 . The method of claim 31 , wherein the peptide is RNVPPIFNDVYWIAFK(Cha)VAAWTLKAAHHHHHH (SEQ ID NO: 67)
33 . The method of claim 26 , wherein A 1 of the peptide is CR, and B of the peptide is RNVPPIFNDVYWIAF (SEQ ID NO: 6).
34 . The method of claim 33 , wherein the peptide is RNVPPIFNDVYWIAFZaK(Cha)VAAWTLKAACR (SEQ ID NO: 161).Join the waitlist — get patent alerts
Track US2023134067A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.