US2023031229A1PendingUtilityA1

Nanobodies against tumor necrosis factor-alpha

Assignee: ABLYNX NVPriority: May 18, 2005Filed: May 27, 2022Published: Feb 2, 2023
Est. expiryMay 18, 2025(expired)· nominal 20-yr term from priority
C07K 16/241C07K 2317/24A61P 9/10C07K 16/468A61P 25/00C07K 2317/31A61P 37/00A61P 25/18A61P 19/02C07K 16/24A61P 31/18A61P 35/00A61P 3/02C07K 16/18A61P 3/10A61P 1/04C12N 15/09C07K 2317/565A61P 37/06A61P 5/14A61P 27/16A61P 37/04A61P 17/00A61P 15/08C07K 2319/31A61P 11/00A61P 15/00A61P 25/24C07K 2317/22A61P 37/08C12N 5/10C07K 14/525A61P 43/00A61P 17/02A61P 1/16A61P 37/02C12P 21/02A61P 11/06A61P 13/12A61K 39/395A61P 5/40B82Y 5/00A61P 21/04A61P 29/02A61P 7/00A61P 25/08A61P 25/32A61P 25/36A61P 31/08A61P 27/02A61P 17/06C07K 19/00A61P 7/06A61K 2039/505A61P 29/00A61P 9/00A61P 25/28A61P 25/16
81
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The present invention relates to improved Nanobodies™ against Tumor Necrosis Factor-alpha (TNF-alpha), as well as to polypeptides comprising or essentially consisting of one or more of such Nanobodies. The invention also relates to nucleic acids encoding such Nanobodies and polypeptides; to methods for preparing such Nanobodies and polypeptides; to host cells expressing or capable of expressing such Nanobodies or polypeptides; to compositions comprising such Nanobodies, polypeptides, nucleic acids or host cells; and to uses of such Nanobodies, such polypeptides, such nucleic acids, such host cells or such compositions, in particular for prophylactic, therapeutic or diagnostic purposes, such as the prophylactic, therapeutic or diagnostic purposes.

Claims

exact text as granted — not AI-modified
1 .- 111 . (canceled) 
     
     
         112 . A polypeptide comprising the amino acid sequence of: DVQLVESGGGLVQPGGSLKLSCAASGFDFSX 31 X 32 WMYWVRQAPGKELEWLSEINTNG LITX 59 YX 61 DSVKGRFTVSRNNAANKMYLELTRLEPEDTALYYCARX 99 X 100 X 101 GX 103 NK GQGTQVTVSS (SEQ ID NO: 477), wherein:
 the amino acid of X 31  is a polar amino acid selected from the group consisting of G, S, T, C, N, Q, Y, K, R, H, D and E;   the amino acid of X 32  is a polar amino acid selected from the group consisting of G, S, T, C, N, Q, Y, K, R, H, D and E;   the amino acid of X 59  is a polar, positively charged amino acid selected from the group consisting of K, R, and H;   the amino acid of X 61  is a small aliphatic, nonpolar or slightly polar residue selected from the group consisting of A, S, T, P, and G;   the amino acid of X 99  is a polar, uncharged amino acid selected from the group consisting of G, S, T, C, N, Q, and Y;   the amino acid of X 100  is any amino acid;   the amino acid of X 101  is a polar amino acid selected from the group consisting of G, S, T, C, N, Q, Y, K, R, H, D, and E; and   the amino acid of X 103  is a nonpolar, uncharged amino acid selected from the group consisting of A, V, L, I, F, M, W, and P.   
     
     
         113 . The polypeptide of  claim 112 , wherein the polypeptide binds human TNFα. 
     
     
         114 . A pharmaceutical composition comprising the polypeptide of 112. 
     
     
         115 . The pharmaceutical composition of  claim 114 , further comprising one or more excipients. 
     
     
         116 . A method for treating a Tumor Necrosis Factor-α (TNF-α) related disorder comprising administering, to a subject in need thereof, an effective amount of the pharmaceutical composition of  claim 114 . 
     
     
         117 . The method of  claim 116 , wherein the disorder is Crohn's disease, ulcerative colitis or inflammatory bowel syndrome.

Join the waitlist — get patent alerts

Track US2023031229A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.