US2022288183A1PendingUtilityA1

Vaccine constructs and uses thereof against staphylococcus infections

Assignee: SOCPRA SCIENCES ET GENIES S E CPriority: Oct 21, 2016Filed: Apr 5, 2022Published: Sep 15, 2022
Est. expiryOct 21, 2036(~10.2 yrs left)· nominal 20-yr term from priority
C12N 15/85C12N 15/74A61K 39/085A61P 37/04C07K 14/31A61K 2039/522C12N 15/62A61K 2039/552A61P 31/04C07K 2319/00C07K 2319/21C12N 15/09C07K 7/08
57
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

There is provided a fusion construct of formula (I): X-A-linker-B-Z (I) wherein: (1) A and B are identical or different and are independently: (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of the sequences depicted in FIG. 24 (SEQ ID NOs: 5 and 121 to 131), a SACOL264 polypeptide (SEQ ID NO: 185), a SACOL0442 polypeptide as set forth in any one of the sequences depicted in FIG. 22D (SEQ ID NOs: 29 and 82 to 92), a SACOL0718 polypeptide (SEQ ID NO: 186), a SACOL0720 polypeptide as set forth in any one of the sequences depicted in FIGS. 23I-J (SEQ ID NOs: 11 and 109 to 120), a SACOL1353 polypeptide (SEQ ID NO: 187), a SACOL1416 polypeptide (SEQ ID NO: 188), a SACOL1611 polypeptide (SEQ ID NO: 189), a SACOL1867 polypeptide as set forth in any one of the sequences depicted in FIG. 25D (SEQ ID NOs: 152 to 164), a SACOL1912 polypeptide (SEQ ID NO: 43), a SACOL1944 polypeptide (SEQ ID NO: 190), a SACOL2144 polypeptide (SEQ ID NO: 191), a SACOL2365 polypeptide (SEQ ID NO: 192), a SACOL2385 polypeptide (SEQ ID NO: 50) or a SACOL2599 polypeptide (SEQ ID NO: 193), based on the gene nomenclature from the Staphylococcus aureus COL (SACOL) genome set forth in NCBI Reference Sequence NC_002951.2; (b) a polypeptide encoded by a gene from a same operon as a gene encoding the polypeptide of (a); (c) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a) or (b); (d) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) to (c); or (e) a polypeptide comprising an immunogenic variant comprising at least 13 consecutive amino acids of any one of (a) to (c); (2) the linker is an amino acid sequence of at least one amino acid or is absent; (3) X is absent or is an amino acid sequence of at least one amino acid; and (4) Z is absent or is an amino acid sequence of at least one amino acid. Also provided are compositions and kits comprising the fusion and uses of these fusions, compositions and kits.

Claims

exact text as granted — not AI-modified
1 . A fusion construct of formula (I):
   X-A-linker-B-Z  (1)
   wherein
 (1) A and B are different and
 (a) wherein A is a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of SEQ ID NOs: 5 and 121 to 131, or a SACOL0442 polypeptide as set forth in any one of SEQ ID NOs: 29 and 82 to 92, and
 wherein B is a SACOL0720 polypeptide as set forth in any one of SEQ ID NOs: 11 and 109 to 120, a SACOL 1867 polypeptide as set forth in any one of SEQ ID NOs: 152 to 164, or a SACOL0442 polypeptide as set forth in any one of SEO ID NOs: 29 and 82 to 92; 
 
 (b) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a); or 
 (c) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) or (b); 
 
 (2) the linker is an amino acid sequence of at least one amino acid or is absent; 
 (3) X is absent or is an amino acid sequence of at least one amino acid; and 
 (4) Z is absent or is an amino acid sequence of at least one amino acid. 
   
     
     
         2 . The construct of  claim 1 , wherein A is a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of SEQ ID NOs: 5 and 121 to 131, or a SACOL0442 polypeptide as set forth in any one of SEQ ID NOs: 29 and 82 to 92, and B is a SACOL0720 polypeptide as set forth in any one of SEQ ID NOs: 11 and 109 to 120, or a SACOL 1867 polypeptide as set forth in any one of SEQ ID NOs: 152 to 164. 
     
     
         3 . The construct of  claim 1 , wherein A is
 (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of SEQ ID NOs: 5 and 121 to 131;   (b) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a); or   (c) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) or (b);   and B is
 (i) a polypeptide comprising a SACOL1867 polypeptide as set forth in any one of SEQ ID NOs: 152 to 164; 
 (ii) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (i); or 
 (iii) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (i) or (ii). 
   
     
     
         4 . The construct of  claim 1 , wherein is
 (a) a polypeptide comprising a SACOL0442 polypeptide as set forth in any one of SEQ ID NOs: 29 and 82 to 92;   (b) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a); or   (c) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) or (b);   and B is   (a′) a polypeptide comprising a SACOL0720 polypeptide as set forth in any one of the SEQ ID NOs: 11 and 109 to 120;   (b′) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a′); or   (c′) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a′) or (b′).   
     
     
         5 . The construct of claim  22 L
 wherein A is
 (a) a polypeptide comprising a SACOL0029 polypeptide as set forth in any one of SEO ID NOs: 5 and 121 to 131; 
   (b) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (a); or   (c) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (a) or (b); and   B is
 (1) a polypeptide comprising a SACOL0442 polypeptide as set forth in any one of SEO ID NOs: 29 and 82 to 92; 
 (2) a polypeptide comprising an immunogenic fragment of at least 13 consecutive amino acids of (1) or (1); or 
 (3) a polypeptide comprising an amino acid sequence at least 60% identical overall to the sequence of the polypeptide of any one of (1) or (2). 
   
     
     
         6 . The construct of  claim 1 , wherein the immunogenic fragment (b) comprises an amino acid sequence selected from the group consisting of 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 34) 
                 
                     
                   KDTINGKSNKSRNW[[;]] 
                 
                     
                   and 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 1) 
                 
                     
                   KDGGKYTLESHKELQ. 
                 
             
                
                
                
                
                
                
               
            
           
         
       
     
     
         7 . The construct of  claim 6 , wherein the immunogenic fragment (c) comprises an amino acid sequence selected from the group consisting of: 
       
         
           
                 
               
                   (SEQ ID NO: 30) 
                 
                   STQNSSSVQDKQLQKVEEVPNNSEKALVKKLYDRYSKDTINGKSNKSRN 
                 
                     
                 
                   WVYSERPLNENQVRIHLEGTYTVAGRVYTPKRNITLNKEWTLKELDHII 
                 
                     
                 
                   RFAHISYGLYMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINT 
                 
                     
                 
                   ADIKNVTFKLVKSVNDIEQV; 
                 
                     
                 
                   (SEQ ID NO: 32) 
                 
                   DKQLQKVEEVPNNSEKALVKKLYDRYSKDTINGKSNKSRNWVYSERPLN 
                 
                     
                 
                   ENQVRIHLEGTYTVAGRVYTPKRNITLNKEWTLKELDHIIRFAHISYGL 
                 
                     
                 
                   YMGEHLPKGNIVINTK; 
                 
                   and 
                 
                     
                 
                   (SEQ ID NO: 33) 
                 
                   DKQLQKVEEVPNNSEKALVKKLYDRYSKDTINGKSNKSRNWVYSERPLN 
                 
                     
                 
                   ENQVRIHLEGTYTVAGRVYTPKRNITLNKEWTLKELDHIIRFAHISYGL 
                 
                     
                 
                   YMGEHLPKGNIVINTKDGGKYTLESHKELQKDRENVKINTADIKNVTFK 
                 
                     
                 
                   LVKSVNDIEQV. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         8 . The construct of  claim 1 , wherein the immunogenic fragment (c) comprises an amino acid sequence selected from the group consisting of: 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 21) 
                 
                     
                   QFGFDLKHKKDALA; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 22) 
                 
                     
                   TIKDQQKANQLAS; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 23) 
                 
                     
                   KDINKIYFMTDVDL; 
                 
                     
                   and 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 24) 
                 
                     
                   DVDLGGPTFVLND. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         9 . The construct of  claim 1 , wherein the immunogenic fragment (c) comprises an amino acid sequence selected from the group consisting of: 
       
         
           
                 
                 
               
                   (SEQ ID NO: 12) 
                     
                 
                   RASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHTKLYKDNLFDVKAK 
                     
                 
                     
                 
                   EPYNVTITSDKYIPNTDLKRGQADLFVAEGSIKOLVKHKKHGKAIIGTKKHHVNIKLRKDIN 
                 
                     
                 
                   KIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHKKDALALEKAKNKVDKS 
                 
                     
                 
                   IETRSEAISSISSLTG; 
                 
                     
                 
                   (SEQ ID NO: 13) 
                     
                 
                   ASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHTKLYKDNLFDVKAKEP 
                     
                 
                     
                 
                   YNVTITSDKYIPNTDLKRGQADLFVAEGSIKOLVKHKKHGKAIIGTKKHHVNIKLRKDINKIY 
                 
                     
                 
                   FMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHKKDALALEKAKNKVDKSIET 
                 
                     
                 
                   RSEAISSISSLTG; 
                 
                     
                 
                   (SEQ ID NO: 14) 
                     
                 
                   ASLSSEIKYTAPHDVTIKDQQKANQLASELNNQKIPHFYNYKEVIHTKLYKDNLFDVKAKEP 
                     
                 
                     
                 
                   YNVTITSDKYIPNTDLKRGQADLFVAEGSIKDLVKHKKHGKAIIGTKKHHVNIKLRKDINKIY 
                 
                     
                 
                   FMTDVDLGGPTFVLNDKDYQE; 
                 
                     
                 
                   (SEQ ID NO: 15) 
                     
                 
                   KDINKIYFMTDVDLGGPTFVLNDKDYQEIRKYTKAKHIVSQFGFDLKHKKDALA; 
                     
                 
                     
                 
                   (SEQ ID NO: 17) 
                     
                 
                   KDINKIYFMTDVDLGGPTFVLNDKDY; 
                     
                 
                     
                 
                   (SEQ ID NO: 16) 
                     
                 
                   KDINKIYFMTDVDLGGPTFVLNDKD; 
                     
                 
                     
                 
                   (SEQ ID NO: 19) 
                     
                 
                   KDINKIYFMTDVDLGGPTFVLND; 
                     
                 
                     
                 
                   (SEQ ID NO: 20) 
                     
                 
                   KHIVSQFGFDLKHKKDALA 
                     
                 
                   and 
                 
                     
                 
                   (SEQ ID NO: 18) 
                     
                 
                   SQFGFDLKHKKDALA. 
                     
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         10 . The construct of  claim 1 , wherein the immunogenic fragment (b) comprises an amino acid sequence selected from the group consisting of: 
       
         
           
                 
                 
               
                     
                   (SEQ ID NO: 165) 
                 
                     
                   PYNGWSFKDATGF; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 167) 
                 
                     
                   AHPNGDKGNGGIYK; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 169) 
                 
                     
                   SISDYPGDEDISVM; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 172) 
                 
                     
                   RGPKGFNFNENVQA; 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 175) 
                 
                     
                   QFESTGTIKRIKDN; 
                 
                     
                   and 
                 
                     
                     
                 
                     
                   (SEQ ID NO: 178) 
                 
                     
                   GNSGSPVLNSNNEV. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         11 . The construct of  claim 10 , wherein the immunogenic fragment (c) comprises the following amino acid sequence: 
       
         
           
                 
               
                   (SEQ ID NO: 39) 
                 
                   TQVKDTNIFPYNGWSFKDATGFVIGKNTIITNKHVSKDYKVGDRITAHP 
                 
                     
                 
                   NGDKGNGGIYKIKSISDYPGDEDISVMNIEEQAVERGPKGFNFNENVQA 
                 
                     
                 
                   FNFAKDAKVDDKIKVIGYPLPAQNSFKQFESTGTIKRIKDNILNFDAYI 
                 
                     
                 
                   EPGNSGSPVLNSNNEVIGWYGGIGKIGSEYNGAVYFTPQIKDFIQKHIE 
                 
                     
                 
                   Q. 
                 
             
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         12 . The construct of  claim 1 , wherein the linker comprises at least four identical or different amino acids selected from the group consisting of glycine, serine, alanine, aspartate, glutamate, and lysine. 
     
     
         13 . The construct of  claim 1 , wherein the linker comprises (GGGGS)n (SEQ ID NO: 67), (ERKYK)n (SEQ ID NO: 61); or (EAAAK)n (SEQ ID NO: 63), wherein n=1 to 5. 
     
     
         14 . The construct of  claim 1 , wherein the X comprises a polyhistidine of 6 to 10 amino acids. 
     
     
         15 . The construct of  claim 1 , wherein the X is absent. 
     
     
         16 . The construct of  claim 1 , wherein the Z is absent. 
     
     
         17 . An isolated nucleic acid molecule encoding the construct defined in  claim 1 . 
     
     
         18 . A vector comprising the isolated nucleic acid defined in  claim 17 . 
     
     
         19 . A host cell comprising the vector defined in  claim 18 . 
     
     
         20 . The cell of  claim 19 , which is a live attenuated form of  Staphylococcus aureus.    
     
     
         21 . The cell of  claim 20 , wherein the live attenuated form of  Staphylococcus aureus  has a stabilized small colony variant (SCV) phenotype. 
     
     
         22 . The cell of  claim 21 , wherein the live attenuated form of  Staphylococcus aureus  having a stabilized SCV phenotype is a ΔhemBΔ720  S. aureus.    
     
     
         23 . A composition comprising:
 the construct of  claim 1 .   
     
     
         24 . (canceled) 
     
     
         25 . The composition of  claim 23 , wherein the live attenuated form of  Staphylococcus aureus  has a stabilized small colony variant (SCV) phenotype. 
     
     
         26 . The composition of  claim 23 , wherein the adjuvant comprises alum, an oil, saponin, cyclicdiguanosine-5′-monophosphate (c-di-GMP), polyphosphasine, indolicidin, pathogen-associated molecular patterns (PAMPS), liposome or a combination of at least two thereof. 
     
     
         27 . A method for preventing and/or treating a Staphylococcal intramammary infection (IMI) in a mammal comprising administrating to the mammal an effective amount of the construct of  claim 1 . 
     
     
         28 . The method of  claim 27 , wherein the Staphylococcal IMI is caused by one or more  Staphylococcus aureus  strains. 
     
     
         29 . The method of  claim 27 , wherein the mammal is a cow. 
     
     
         30 . (canceled) 
     
     
         31 . (canceled) 
     
     
         32 . (canceled) 
     
     
         33 . (canceled) 
     
     
         34 . (canceled) 
     
     
         35 . (canceled) 
     
     
         36 . A kit for preventing and/or treating a Staphylococcal intramammary infection (IMI) in a mammal comprising the composition of  claim 23 .

Join the waitlist — get patent alerts

Track US2022288183A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.