US2021317173A1PendingUtilityA1
Compositions and methods for fabricating synthetic dragline spider silk
Est. expiryAug 10, 2035(~9 yrs left)· nominal 20-yr term from priority
C07K 2319/21C12N 15/86C12N 15/866C07K 14/43518C12N 2710/14043C12N 15/85C12N 2710/14041
54
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Compositions comprising a mixture of proteins derived from MaSP, nucleic acids encoding same and method for the preparation of synthetic dragline spider silk are provided. The compositions of the invention comprise a mixture of proteins of differing molecular weight, wherein each protein of said mixture comprises, independently, multiple repeats of a repetitive region of a MaSP (major ampullate spidroin) protein or a functional homolog, variant, derivative or fragment thereof.
Claims
exact text as granted — not AI-modified1 . A non-natural proteinous fiber, wherein said proteinous fiber comprise: an amino acid sequence as set forth in SEQ ID NO: 1: (X 1 ) Z X 2 GPGGYGPX 3 X 4 X 5 GPX 6 GX 7 GGX 8 GPGGPGX 9 X 10 , wherein X 1 is, independently, at each instance A or G wherein at least 50% of (X 1 ) Z is A, Z is an integer between 5 to 30; X 2 is S or G; X 3 is G or E; X 4 is G, S or N; X 5 is Q or Y; X 6 is G or S; X 7 is P or R; X 8 is Y or Q; X 9 is G or S; and X 10 is S or G, said proteinous fiber is characterized by a DSC peak at 250° C. to 330° C.
2 . The non-natural proteinous fiber of claim 1 , wherein said proteinous fiber comprises 4 to 32 repeats of said SEQ ID NO: 1.
3 . The non-natural proteinous fiber of claim 1 , wherein said proteinous fiber comprises a first moiety and contiguous thereto a second moiety, the first moiety is an amino acid sequence of 5-30 amino acids comprising at least 50% alanine residues, the second moiety is an amino acid sequence of 20-60 amino acids comprising at least 80% residues selected from the group consisting of glycine, serine, proline and tyrosine, optionally wherein the second comprises at most two glutamine residues.
4 . The non-natural proteinous fiber of claim 1 , wherein said said proteinous fiber comprises the amino acid sequence as set forth in SEQ ID NO: 33.
5 . The non-natural proteinous fiber of claim 1 , wherein said proteinous fiber comprises the amino acid sequence selected from the group consisting of SEQ ID NO: 2 (SGPGGYGPGSQGPSGPGGYGPGGPGSS) and SEQ ID NO: 3 (AAAAAAAASGPGGYGPGSQGPSGPGGYGPGGPGSS).
6 . The non-natural proteinous fiber of claim 1 , wherein said proteinous fiber comprises a single N-terminal region selected from the group consisting of:
SEQ ID NO: 5
(MSYYHHHHHHDYDIPTTENLYFQGAMDPEFKGLRRRAQLV),
SEQ ID NO: 6
(MSYYHHHHHHDYDIPTTENLYFQGAMDPEFKGLRRRAQLVRPLSNLDN
A),
SEQ ID NO: 7
MSYYHHHHHHDYDIPTTENLYFQGAMDPEFKGLRRRAQLVDPPGCRNSA
RAGSS),
or any functional homolog, variant, derivative, or fragment thereof, wherein said homolog of said N-terminal region shares at least 70% homology with any one of SEQ ID NOs: 5-7.
7 . The non-natural proteinous fiber of claim 1 , wherein said proteinous fiber comprises comprises a single C-terminal region as set forth in SEQ ID NO: 9 (GPSGPGAYGPSPSASASVAASRLSSPAASSRVSSAVSSLVSSGPTNGAAVSGALNS LVSQISASNPGLSGCDALVQALLELVSALVAILSSASIGQVNVSSVSQSTQMISQALS), or any functional homolog, variant, derivative, fragment or mutant thereof wherein said homolog of said C-terminal region shares at least 70% homology with SEQ ID NO: 9.
8 . The non-natural proteinous fiber of claim 1 , wherein said proteinous fiber is further characterized by a DSC pattern with an endothermic peak in the range of 220° C. to 250° C.
9 . An article comprising the non-natural proteinous fiber of claim 1 .
10 . A nucleic acid molecule encoding the fiber of claim 1 .
11 . An expression vector comprising the nucleic acid molecule of claim 10 , wherein said nucleic acid molecule is under expression control of an operably linked promoter and, optionally, regulatory sequences.
12 . A host cell transformed with the expression vector of claim 11 .Join the waitlist — get patent alerts
Track US2021317173A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.