US2021169983A1PendingUtilityA1

Compositions and Methods for Treatment of Metabolic Disorders and Diseases

Assignee: NGM BIOPHARMACEUTICALS INCPriority: Nov 28, 2012Filed: Aug 10, 2020Published: Jun 10, 2021
Est. expiryNov 28, 2032(~6.3 yrs left)· nominal 20-yr term from priority
C07K 14/50C07K 2319/00A61K 45/06G01N 33/66A61K 38/1825
66
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The invention relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of FGF19 and/or FGF21, and variants or fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics), having one or more activities, such as glucose lowering activity, and methods for and uses in treatment of hyperglycemia and other disorders.

Claims

exact text as granted — not AI-modified
1 - 79 . (canceled) 
     
     
         80 . A method of reducing body mass in a subject, comprising administering to the subject an effective amount of a peptide, wherein the peptide comprises:
 a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO:121), DASPH (SEQ ID NO:122), or DAGPH (amino acids 7 to 11 of SEQ ID NO:99 [FGF19]); and   b) a C-terminal region comprising a first amino acid position and a last amino acid position, wherein the C-terminal region comprises
 (i) a first C-terminal region sequence comprising WGDPIRQRHLYTSG (SEQ ID NO:169 with a L7Q substitution), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and 
 (ii) a second C-terminal region sequence comprising PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIK GVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNV YRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEE PEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:188); 
    wherein the second C-terminal region sequence comprises a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74 to 78 of SEQ ID NO:188);    and wherein the peptide
 (i) binds to fibroblast growth factor receptor 4 (FGFR4) with an affinity equal to or greater than FGF19 binding affinity for FGFR4; 
 (ii) activates FGFR4 to an extent or amount equal to or greater than FGF19 activates FGFR4; 
 (iii) has at least one of reduced hepatocellular carcinoma (HCC) formation; greater glucose lowering activity, less lipid increasing activity, less triglyceride activity, less cholesterol activity, less non-HDL activity or less HDL increasing activity, as compared to FGF19, or as compared to an FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) or FGDPI (SEQ ID NO:184) substituted for the FGF19 WGDPI (SEQ ID NO:170) sequence at amino acids 16-20; and/or 
 (iv) has less lean mass reducing activity as compared to FGF21;
 thereby reducing body mass in said subject. 
 
   
     
     
         81 . The method of  claim 80 , wherein the second C-terminal region sequence comprises a EILPD (amino acids 103-107 of SEQ ID NO:193) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         82 . The method of  claim 80 , wherein the second C-terminal region sequence comprises a EIRED (amino acids 103-107 of SEQ ID NO:194) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         83 . The method of  claim 80 , wherein the second C-terminal region sequence comprises a), EILCD (amino acids 103-107 of SEQ ID NO:195) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         84 . The method of  claim 80 , wherein the second C-terminal region sequence comprises a EILED (amino acids 103-107 of SEQ ID NO:196) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         85 . The method of  claim 80 , wherein the second C-terminal region sequence comprises a LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         86 . The method of  claim 80 , wherein the second C-terminal region sequence comprises from 2 to 5 amino acid substitutions, deletions or insertions. 
     
     
         87 . The method of  claim 80 , wherein the peptide is less than about 250 amino acids in length. 
     
     
         88 . The method of  claim 80 , wherein
 (i) the N-terminal region comprises amino acid residues VHYG (SEQ ID NO:101), DASPHVHYG (SEQ ID NO:102), or DSSPLVHYG (SEQ ID NO:103), wherein the G corresponds to the last position of the N-terminal region;   (ii) the N-terminal region comprises amino acid residues DSSPLLQ (SEQ ID NO:104), and wherein the Q residue is the last amino acid position of the N-terminal region;   (iii) the N-terminal region comprises amino acid residues DSSPLLQFGGQV (SEQ ID NO:105), and wherein the V residue corresponds to the last position of the N-terminal region; or   (iv) the N-terminal region comprises any one of the following amino acid sequences: MDSSPL (SEQ ID NO:119), MSDSSPL (SEQ ID NO:120), or SDSSPL (SEQ ID NO:112).   
     
     
         89 . The method of  claim 80 , wherein the N-terminal region comprises amino acid residues
 DAGPHVH (amino acids 7-13 of SEQ ID NO:16), wherein the last H residue corresponds to the last amino acid position of the N-terminal region;   DAGPHVG (amino acids 7-13 of SEQ ID NO:17), wherein the last G residue corresponds to the last amino acid position of the N-terminal region;   DAGPHYG (amino acids 7-13 of SEQ ID NO:18), wherein the last G residue corresponds to the last amino acid position of the N-terminal region;   DAGPHVHG (amino acids 7-14 of SEQ ID NO:22), wherein the last G residue corresponds to the last amino acid position of the N-terminal region;   DAGPHHG (amino acids 7-13 of SEQ ID NO:23), wherein the last G residue corresponds to the last amino acid position of the N-terminal region;   DAGPHHY (amino acids 7-13 of SEQ ID NO:24), wherein the Y residue corresponds to the last amino acid position of the N-terminal region;   DAGPHVY (amino acids 7-13 of SEQ ID NO:25), wherein the Y residue corresponds to the last amino acid position of the N-terminal region;   DAGPHV (amino acids 7-12 of SEQ ID NO:28), wherein the V residue corresponds to the last amino acid position of the N-terminal region;   DAGPHVHY (amino acids 7-14 of SEQ ID NO:29), wherein the Y residue corresponds to the last amino acid position of the N-terminal region;   DAGPHVHYA (amino acids 7-15 of SEQ ID NO:4), wherein the last A residue corresponds to the last amino acid position of the N-terminal region;   DAGPHLQ (amino acids 7-13 of SEQ ID NO:66), wherein the Q residue corresponds to the last amino acid position of the N-terminal region; or   DAGPHVHYG (amino acids 7-15 of SEQ ID NO:196), wherein the last G residue corresponds to the last amino acid position of the N-terminal region.   
     
     
         90 . The method of  claim 80 , wherein the N-terminal region further comprises:
 RHPIP (SEQ ID NO:106), wherein R is the first amino acid position of the N-terminal region;   HPIP (SEQ ID NO:107), wherein H is the first amino acid position of the N-terminal region;   RPLAF (SEQ ID NO:108), wherein R is the first amino acid position of the N-terminal region;   PLAF (SEQ ID NO:109), wherein P is the first amino acid position of the N-terminal region; or   R, wherein R is the first amino acid position of the N-terminal region.   
     
     
         91 . The method of  claim 80 , wherein
 the first position of the N-terminal region is a R or M residue;   the first and second positions of the N-terminal region is a MR, RM, RD, DS, MD or MS sequence;   the first through third positions of the N-terminal region is a MDS, RDS, MSD, MSS, or DSS sequence;   the first through fourth positions of the N-terminal region is a RDSS (SEQ ID NO:115) or MDSS (SEQ ID NO:116) sequence;   the first through fifth positions of the N-terminal region is an MRDSS (SEQ ID NO:117) sequence;   the first through sixth positions of the N-terminal region is an MDSSPL (SEQ ID NO:119) sequence; or   the first through seventh positions of the N-terminal region is an MSDSSPL (SEQ ID NO:120) sequence.   
     
     
         92 . The method of  claim 80 , wherein the N-terminal region has an amino acid sequence comprising or consisting of any of: 
       
         
           
                 
                 
               
                     
                   (M1) 
                 
                     
                   (amino acids 1-15 of SEQ ID NO: 1) 
                 
                     
                   RPLAFSDASPHVHYG; 
                 
                     
                     
                 
                     
                   (M1-R) 
                 
                     
                   (amino acids 2-15 of SEQ ID NO: 1) 
                 
                     
                   PLAFSDASPHVHYG; 
                 
                     
                     
                 
                     
                   (M2) 
                 
                     
                   (amino acids 1-15 of SEQ ID NO: 2) 
                 
                     
                   RPLAFSDSSPLVHYG; 
                 
                     
                     
                 
                     
                   (M2-R) 
                 
                     
                   (amino acids 2-15 of SEQ ID NO: 2) 
                 
                     
                   PLAFSDSSPLVHYG; 
                 
                     
                     
                 
                     
                   (M8) 
                 
                     
                   (amino acids 1-12 of SEQ ID NO: 8) 
                 
                     
                   RHPIPDSSPLLQ; 
                 
                     
                     
                 
                     
                   (M9) 
                 
                     
                   (amino acids 1-12 of SEQ ID NO: 9) 
                 
                     
                   RHPIPDSSPLLQFG; 
                 
                     
                     
                 
                     
                   (M26) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 26) 
                 
                     
                   RPLAFSDSSPLVH; 
                 
                     
                     
                 
                     
                   (M26-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 26) 
                 
                     
                   PLAFSDSSPLVH; 
                 
                     
                     
                 
                     
                   (M47) 
                 
                     
                   (amino acids 1-11 of SEQ ID NO: 47) 
                 
                     
                   HPIPDSSPLLQ; 
                 
                     
                     
                 
                     
                   (M52) 
                 
                     
                   (amino acids 1-8 of SEQ ID NO: 52) 
                 
                     
                   RDSSPLLQ; 
                 
                     
                     
                 
                     
                   (M52-R) 
                 
                     
                   (amino acids 2-8 of SEQ ID NO: 52) 
                 
                     
                   DSSPLLQ; 
                 
                     
                     
                 
                     
                   (M53) 
                 
                     
                   (amino acids 1-10 of SEQ ID NO: 53) 
                 
                     
                   MDSSPLVHYG; 
                 
                     
                     
                 
                     
                   (M69) 
                 
                     
                   (amino acids 1-10 of SEQ ID NO: 69) 
                 
                     
                   RDSSPLVHYG; 
                 
                     
                     
                 
                     
                   (M69-R) 
                 
                     
                   (amino acids 2-10 of SEQ ID NO: 69) 
                 
                     
                   DSSPLVHYG; 
                 
                     
                     
                 
                     
                   (M70) 
                 
                     
                   (amino acids 1-11 of SEQ ID NO: 70) 
                 
                     
                   MRDSSPLVHYG; 
                 
                     
                     
                 
                     
                   (M9-R) 
                 
                     
                   (amino acids 1-9 of SEQ ID NO: 141) 
                 
                     
                   DSSPLVHYG; 
                 
                     
                     
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 163) 
                 
                     
                   HPIPDSSPLLQFG; 
                 
                     
                     
                 
                     
                   (M16) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 16) 
                 
                     
                   RPLAFSDAGPHVH; 
                 
                     
                     
                 
                     
                   (M16-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 16) 
                 
                     
                   PLAFSDAGPHVH; 
                 
                     
                     
                 
                     
                   (M17) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 17) 
                 
                     
                   RPLAFSDAGPHVG; 
                 
                     
                     
                 
                     
                   (M17-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 17) 
                 
                     
                   PLAFSDAGPHVG; 
                 
                     
                     
                 
                     
                   (M18) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 18) 
                 
                     
                   RPLAFSDAGPHYG; 
                 
                     
                     
                 
                     
                   (M18-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 18) 
                 
                     
                   PLAFSDAGPHYG; 
                 
                     
                     
                 
                     
                   (M22) 
                 
                     
                   (amino acids 1-14 of SEQ ID NO: 22) 
                 
                     
                   RPLAFSDAGPHVHG; 
                 
                     
                     
                 
                     
                   (M22-R) 
                 
                     
                   (amino acids 2-14 of SEQ ID NO: 22) 
                 
                     
                   PLAFSDAGPHVHG; 
                 
                     
                     
                 
                     
                   (M23) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 23) 
                 
                     
                   RPLAFSDAGPHHG; 
                 
                     
                     
                 
                     
                   (M23-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 23) 
                 
                     
                   PLAFSDAGPHHG; 
                 
                     
                     
                 
                     
                   (M24) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 24) 
                 
                     
                   RPLAFSDAGPHHY; 
                 
                     
                     
                 
                     
                   (M24-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 24) 
                 
                     
                   PLAFSDAGPHHY; 
                 
                     
                     
                 
                     
                   (M25) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 25) 
                 
                     
                   RPLAFSDAGPHVY; 
                 
                     
                     
                 
                     
                   (M25-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 25) 
                 
                     
                   PLAFSDAGPHVY; 
                 
                     
                     
                 
                     
                   (M28) 
                 
                     
                   (amino acids 1-12 of SEQ ID NO: 28) 
                 
                     
                   RPLAFSDAGPHV; 
                 
                     
                     
                 
                     
                   (M28-R) 
                 
                     
                   (amino acids 2-12 of SEQ ID NO: 28) 
                 
                     
                   PLAFSDAGPHV; 
                 
                     
                     
                 
                     
                   (M29) 
                 
                     
                   (amino acids 1-14 of SEQ ID NO: 29) 
                 
                     
                   RPLAFSDAGPHVHY; 
                 
                     
                     
                 
                     
                   (M29-R) 
                 
                     
                   (amino acids 2-14 of SEQ ID NO: 29) 
                 
                     
                   PLAFSDAGPHVHY; 
                 
                     
                     
                 
                     
                   (M4) 
                 
                     
                   (amino acids 1-15 of SEQ ID NO: 4) 
                 
                     
                   RPLAFSDAGPHVHYA; 
                 
                     
                     
                 
                     
                   (M4-R) 
                 
                     
                   (amino acids 2-15 of SEQ ID NO: 4) 
                 
                     
                   PLAFSDAGPHVHYA; 
                 
                     
                     
                 
                     
                   (M66) 
                 
                     
                   (amino acids 1-13 of SEQ ID NO: 66) 
                 
                     
                   RPLAFSDAGPHLQ; 
                 
                     
                     
                 
                     
                   (M66-R) 
                 
                     
                   (amino acids 2-13 of SEQ ID NO: 66) 
                 
                     
                   PLAFSDAGPHLQ; 
                 
                     
                     
                 
                     
                   (M160) 
                 
                     
                   (amino acids 1-15 of SEQ ID NO: 196) 
                 
                     
                   RPLAFSDAGPHVHYG; 
                 
                     
                   or 
                 
                     
                     
                 
                     
                   (M160-R) 
                 
                     
                   (amino acids 2-15 of SEQ ID NO: 196) 
                 
                     
                   PLAFSDAGPHVHYG. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         93 . The method of  claim 80 , wherein the N-terminal region first amino acid position is a methionine (M), arginine (R), serine (S), histidine (H), proline (P), leucine (L) or aspartic acid (D) residue. 
     
     
         94 . The method of  claim 80 , wherein the N-terminal region does not have a methionine (M) or arginine (R) residue at the first amino acid position of the N-terminal region. 
     
     
         95 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of:
 i. SEQ ID NO:1 (M1) with a L22Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   ii. SEQ ID NO:2 (M2) with a L22Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   iii. SEQ ID NO:8 (M8) with a L19Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   iv. SEQ ID NO:9 (M9) with a L21Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   v. SEQ ID NO:26 (M26) with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   vi. SEQ ID NO:47 (M47) with a L18Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   vii. SEQ ID NO:52 (M52) with a L15Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   viii. SEQ ID NO:192 (M53) with a L15Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   ix. SEQ ID NO:69 (M69) with a L17Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   x. SEQ ID NO:70 (M70) with a L18Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xi. SEQ ID NO:141 with a L16Q substitution a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xii. SEQ ID NO:163 with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xiii. SEQ ID NO:4 (M4) with a L22Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xiv. SEQ ID NO:16 (M16) with a L20Q substitution a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xv. SEQ ID NO:17 (M17) with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xvi. SEQ ID NO:18 (M18) with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xvii. SEQ ID NO:22 (M22) with a L21Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xviii. SEQ ID NO:23 (M23) with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xix. SEQ ID NO:24 (M24) with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xx. SEQ ID NO:25 (M25) with a L20Q substitution a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xxi. SEQ ID NO:28 (M28) with a L19Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xxii. SEQ ID NO:29 (M29) with a L21Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xxiii. SEQ ID NO:66 (M66) with a L20Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188);   xxiv. SEQ ID NO:193 (M139) with a L22Q substitution;   xxv. SEQ ID NO:194 (M140) with a L22Q substitution;   xxvi. SEQ ID NO:195 (M141) with a L22Q substitution; or   xxvii. SEQ ID NO:196 (M160).   
     
     
         96 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:52 (M52) with a L15Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         97 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:192 (M53) with a L15Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         98 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:69 (M69) with a L17Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         99 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:70 (M70) with a L18Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         100 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:4 (M4) with a L22Q substitution and a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188); 
     
     
         101 . The method of  claim 80 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:196 (M160). 
     
     
         102 . The method of  claim 95 , wherein the arginine (R) residue at the first amino acid position of the N-terminal region of the sequence of  claim 95  (i)-(v), (vii), (ix), and (xiii)-(xxvii) is deleted. 
     
     
         103 . The method of  claim 80 , wherein the peptide has at least one of reduced HCC formation; greater glucose lowering activity, or less lipid increasing activity as compared to FGF19, or as compared to an FGF19 variant having any of GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) or FGDPI (SEQ ID NO:184) substituted for the WGDPI (SEQ ID NO:170) sequence at amino acids 16-20 of FGF19 (SEQ ID NO:99). 
     
     
         104 . The method of  claim 103 , wherein the HCC formation, glucose lowering activity, or lipid increasing activity is ascertained in a db/db mouse. 
     
     
         105 . The method of  claim 80 , wherein the peptide has less lean mass reducing activity as compared to the lean mass reducing activity of FGF21. 
     
     
         106 . The method of  claim 105 , wherein the lean mass reducing activity is ascertained in a db/db mouse. 
     
     
         107 . The method of  claim 80 , wherein the peptide is formulated as a pharmaceutical composition, wherein the pharmaceutical composition further comprises a pharmaceutically acceptable carrier. 
     
     
         108 . The method of  claim 80 , wherein the method further comprises administration of a supplemental therapy. 
     
     
         109 . The method of  claim 108 , wherein said supplemental therapy is a weight loss surgery, gastric bypass, gastrectomy, gastric banding, gastric balloon, or gastric sleeve. 
     
     
         110 . The method of  claim 108 , wherein said supplemental therapy is a glucose lowering agent, insulin, GLP1 analogue, biguanide, sulphonylurea, thiazolidinedione, a dipeptidyl peptidase-4 (DPP-4) inhibitor, a bromocriptine formulation, a bile acid sequestrant, metformin, a thiazolidinedione (TZD), a SGLT-2 inhibitor, or any combination thereof. 
     
     
         111 . The method of  claim 110 , wherein said biguanide or sulphonylurea is selected from the group consisting of tolbutamide, chlorpropamide, acetohexamide, tolazamide, glibenclamide, glipizide or any combination thereof. 
     
     
         112 . The method of  claim 110 , wherein said thiazolidinedione is rosiglitazone or pioglitazone, or combination thereof. 
     
     
         113 . The method of  claim 110 , wherein said bile acid sequestrant is colesevelam. 
     
     
         114 . The method of  claim 110 , wherein said insulin is bolus insulin, basal insulin, or an analogue thereof. 
     
     
         115 . The method of  claim 110 , wherein said metformin is metformin hydrochloride. 
     
     
         116 . The method of  claim 108 , wherein said supplemental therapy is administered prior to said method. 
     
     
         117 . The method of  claim 108 , wherein said supplemental therapy is administered contemporaneously with said method. 
     
     
         118 . The method of  claim 108 , wherein said supplemental therapy is administered following said method. 
     
     
         119 . The method of  claim 80 , wherein the subject has a metabolic disorder. 
     
     
         120 . The method of  claim 80 , wherein the subject has an insulin resistance disorder. 
     
     
         121 . The method of  claim 80 , wherein the subject has hyperinsulinemia. 
     
     
         122 . The method of  claim 80 , wherein the subject has glucose intolerance. 
     
     
         123 . The method of  claim 80 , wherein the subject has a hyperglycemic disorder or is at risk of developing a hyperglycemic disorder. 
     
     
         124 . The method of  claim 80 , wherein the subject has diabetes. 
     
     
         125 . The method of  claim 80 , wherein the subject has insulin-dependent (type I) diabetes. 
     
     
         126 . The method of  claim 80 , wherein the subject has type II diabetes. 
     
     
         127 . The method of  claim 80 , wherein the subject has gestational diabetes. 
     
     
         128 . The method of  claim 80 , wherein the subject is obese. 
     
     
         129 . The method of  claim 80 , wherein the subject has a body mass index greater than 25. 
     
     
         130 . The method of  claim 80 , wherein the subject has a body mass index greater than 40. 
     
     
         131 . The method of  claim 80 , wherein the subject has nonalcoholic fatty liver disease (NAFLD). 
     
     
         132 . The method of  claim 80 , wherein the subject has nonalcoholic steatohepatitis (NASH).

Join the waitlist — get patent alerts

Track US2021169983A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.