US2021017289A1PendingUtilityA1
Anti-ox40 antibodies and their uses
Est. expiryDec 15, 2036(~10.4 yrs left)· nominal 20-yr term from priority
Inventors:Fiona A. Harding
C07K 16/3023C07K 16/2896C07K 16/2878C07K 16/2875A61P 35/00C07K 2317/75C07K 2317/56A61K 2039/505C12N 15/85C07K 2317/24C07K 2317/92C07K 2317/73
75
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present disclosure provides novel anti-OX40 antibodies, compositions including the antibodies, nucleic acids encoding the antibodies, and methods of making and using the same.
Claims
exact text as granted — not AI-modifiedWhat is claimed is:
1 . An anti-OX40 antibody which comprises (i) a V H chain comprising three CDRs; and (ii) a V L chain comprising three CDRs, wherein:
V H CDR#1 has an amino acid sequence:
(SEQ ID NO: 101)
GFTFSRYGMS,
V H CDR#2 has an amino acid sequence:
(SEQ ID NO: 102)
TINSNGGRTYYPDSVKG,
V H CDR#3 has an amino acid sequence:
(SEQ ID NO: 103)
EGITTAYAMDY,
V L CDR#1 has an amino acid sequence:
(SEQ ID NO: 104)
KASQSVDYDGDSYMH,
V L CDR#2 has an amino acid sequence:
(SEQ ID NO: 105)
AASILES,
and
V L CDR#3 has an amino acid sequence:
(SEQ ID NO: 106)
QQSNEDPRT.
2 . The anti-OX40 antibody of claim 1 , which is monoclonal.
3 . The anti-OX40 antibody of claim 1 , which is humanized.
4 . The anti-OX40 antibody of claim 3 , which comprises a V H chain having an amino acid sequence according to:
(SEQ ID NO: 22)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYGMSWVRQAPGKGLELVA
TINSNGGRTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR
EGITTAYAMDYWGQGTTVTVSS;
and a V L chain having an amino acid sequence according to:
(SEQ ID NO: 32)
DIVMTQSPDSLAVSLGERATINCKASQSVDYDGDSYMHWYQQKPGQPPK
LLIYAASILESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNED
PRTFGGGTKVEIK.
5 . The anti-OX40 antibody of claim 3 , which is an IgG.
6 . The anti-OX40 antibody of claim 5 , which is an IgG 1 .
7 . The anti-OX40 antibody of claim 3 comprising a kappa light chain constant region.
8 . The anti-OX40 antibody of claim 1 which comprises a heavy chain having an amino acid sequence according to SEQ ID NOS: 41 or 42; and a light chain having an amino acid sequence according to SEQ ID NO: 51.
9 . The anti-OX40 antibody of claim 1 which has a k d against human OX40 (SEQ ID NO:1) of less than about 1 sec −1 .
10 . The anti-OX40 antibody of claim 1 which has a K D against human OX40 (SEQ ID NO:1) of less than about 100 nM.
11 . A pharmaceutical composition comprising the anti-OX40 antibody of claim 1 , and a pharmaceutically acceptable carrier.
12 . A nucleic acid comprising a nucleotide sequence encoding an anti-OX40 antibody which comprises (i) a V H chain comprising three CDRs; and (ii) a V L chain comprising three CDRs, wherein:
V H CDR#1 has an amino acid sequence:
(SEQ ID NO: 101)
GFTFSRYGMS,
V H CDR#2 has an amino acid sequence:
(SEQ ID NO: 102)
TINSNGGRTYYPDSVKG,
V H CDR#3 has an amino acid sequence:
(SEQ ID NO: 103)
EGITTAYAMDY,
V L CDR#1 has an amino acid sequence:
(SEQ ID NO: 104)
KASQSVDYDGDSYMH,
V L CDR#2 has an amino acid sequence:
(SEQ ID NO: 105)
AASILES,
and
V L CDR#3 has an amino acid sequence:
(SEQ ID NO: 106)
QQSNEDPRT.
13 . A vector comprising the nucleic acid of claim 12 .
14 . A prokaryotic host cell transformed with the vector of claim 12 .
15 . A eukaryotic host cell transformed with the vector of claim 12 .
16 . The eukaryotic host cell of claim 15 which is a mammalian host cell.
17 . A method of producing an anti-OX40 antibody, comprising: (a) culturing the host cell of claim 16 and (b) recovering the anti-OX40 antibody.
18 . A method of treating a cancer, comprising administering to a patient in need thereof an effective amount of an anti-OX40 antibody which comprises (i) a V H chain comprising three CDRs; and (ii) a V L chain comprising three CDRs, wherein:
V H CDR#1 has an amino acid sequence:
(SEQ ID NO: 101)
GFTFSRYGMS,
V H CDR#2 has an amino acid sequence:
(SEQ ID NO: 102)
TINSNGGRTYYPDSVKG,
V H CDR#3 has an amino acid sequence:
(SEQ ID NO: 103)
EGITTAYAMDY,
V L CDR#1 has an amino acid sequence:
(SEQ ID NO: 104)
KASQSVDYDGDSYMH,
V L CDR#2 has an amino acid sequence:
(SEQ ID NO: 105)
AASILES,
and
V L CDR#3 has an amino acid sequence:
(SEQ ID NO: 106)
QQSNEDPRT.
19 . The method of claim 18 , wherein the cancer is selected from bladder cancer, breast cancer, head and neck cancer, gastric cancer, kidney cancer, liver cancer, lung cancer, ovarian cancer, skin cancer, and a tumor with evidence of DNA mismatch repair deficiency.
20 . The method of claim 19 , wherein the lung cancer is small cell lung cancer, non-small cell lung cancer, or mesothelioma.Join the waitlist — get patent alerts
Track US2021017289A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.