Peptide compounds and compositions thereof

Abstract

Peptide compounds and compositions containing the peptide compounds and methods for treating various infections, wounds, and skin conditions such as atopic dermatitis. Examples of wounds that may be treated include surface wounds such as lacerations, abrasions, avulsions, incisions, and amputations, pressure sores, bed sores, wounds due to peripheral vascular disease, post-surgical wounds, diabetic ulcers and wounds, burns, ocular wounds and abrasions, ocular ulcers, and treatment of inflammatory conditions such as dry eye. The peptide compounds and compositions may be used as treatments to enhance acceptance of grafts such as skin grafts and organ grafts.

What is claimed is: 
     
         1 . A topical composition, comprising:
 a peptide compound comprising a sequence selected from the group consisting of:   
       
         
           
                 
               
                   (SEQ ID NO: 48) 
                 
                   (AEEA)-(AEEA)-RRRRLDREANLTSSVTILPLPLQNATVEAGTRR, 
                 
                   and 
                 
                     
                 
                   (SEQ ID NO: 50) 
                 
                   (AEEA)-(AEEA)-RRRRTSSVTILPLPLQNATVEAGTRR, 
                 
             
                
                
                
                
                
                
               
            
           
         
         
           wherein AEEA is NH 2 CH 2 CH 2 OCH 2 CH 2 OCH 2 CO—; and 
         
         a pharmaceutically-acceptable vehicle, carrier, or diluent which promotes transdermal absorption of the peptide compound. 
       
     
     
         2 . The topical composition of  claim 1 , comprising a lotion, paste, gel, cream, ointment, powder, spray, or aerosol. 
     
     
         3 . A topical composition, comprising:
 a peptide compound comprising a sequence selected from the group consisting of:   
       
         
           
                 
               
                   (SEQ ID NO: 46) 
                 
                   (AEEP)-(AEEP)-RRRRLDREANLTSSVTILPLPLQNATVEAGTRR, 
                 
                   and 
                 
                     
                 
                   (SEQ ID NO: 49) 
                 
                   (AEEP)-(AEEP)-RRRRTSSVTILPLPLQNATVEAGTRR, 
                 
             
                
                
                
                
                
                
               
            
           
         
         
           wherein AEEP is NH 2 CH 2 CH 2 OCH 2 CH 2 OCH 2 CH 2 CO—; and 
         
         a pharmaceutically-acceptable vehicle, carrier, or diluent which promotes transdermal absorption of the peptide compound. 
       
     
     
         4 . The topical composition of  claim 3 , comprising a lotion, paste, gel, cream, ointment, powder, spray, or aerosol. 
     
     
         5 . A topical composition, comprising:
 a peptide compound comprising a sequence selected from the group consisting of:   
       
         
           
                 
               
                   (SEQ ID NO: 51) 
                 
                   (AEEA)-(AEEA)-RRRRGTRCQVAGWGSWHSGGRLSRFPRFVNVR, 
                 
                   and 
                 
                     
                 
                   (SEQ ID NO: 35) 
                 
                   (AEEP)-(AEEP)-RRRRGTRCQVAGWGSWHSGGRLSRFPRFVNVR, 
                 
             
                
                
                
                
                
                
               
            
           
         
         
           wherein AEEA is NHCH 2 CH 2 OCH 2 CH 2 OCH 2 CO—, and AEEP is NH 2 CH 2 CH 2 OCH 2 CH 2 OCH 2 CH 2 CO—; and 
         
         a pharmaceutically-acceptable vehicle, carrier, or diluent which promotes transdermal absorption of the peptide compound. 
       
     
     
         6 . The topical composition of  claim 5 , comprising a lotion, paste, gel, cream, ointment, powder, spray, or aerosol.