US2019175693A1PendingUtilityA1

Methods of Using Compositions Comprising Variants and Fusions of FGF19 Polypeptides for Treatment of Cirrhosis

Assignee: NGM BIOPHARMACEUTICALS INCPriority: Dec 27, 2012Filed: Feb 21, 2019Published: Jun 13, 2019
Est. expiryDec 27, 2032(~6.4 yrs left)· nominal 20-yr term from priority
A61P 3/06A61P 3/10A61P 3/00C07K 14/50A61P 1/16A61K 38/1825C12Q 1/6883G01N 33/92C12Q 2600/136C12Q 2600/158A61P 1/12C12Q 2600/106G01N 2800/04G01N 2800/08G01N 2500/04
66
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The invention relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of FGF19 and/or FGF21, and variants or fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics), having one or more activities, such as bile acid homeostasis modulating activity, and methods for and uses in treatment of bile acid and other disorders.

Claims

exact text as granted — not AI-modified
1 - 72 . (canceled) 
     
     
         73 . A method of treating a subject having cirrhosis, comprising administering to the subject an effective amount of a peptide, wherein said peptide comprises:
 a) an N-terminal region comprising at least seven amino acid residues, the N-terminal region having a first amino acid position and a last amino acid position, wherein the N-terminal region comprises DSSPL (SEQ ID NO:121) or DASPH (SEQ ID NO:122); and   b) a C-terminal region having a first amino acid position and a last amino acid position, wherein the C-terminal region comprises
 (i) a first C-terminal region sequence comprising WGDPIRLRHLYTSG (amino acids 16 to 29 of SEQ ID NO:99 [FGF19]), wherein the W residue corresponds to the first amino acid position of the C-terminal region; and 
 (ii) a second C-terminal region sequence comprising PHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKG VHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRS EKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDL RGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (amino acid residues 30 to 194 of SEQ ID NO:99 [FGF19]); or a sequence comprising from 1 to 5 amino acid substitutions, deletions or insertions thereof; 
   wherein the peptide
 (i) binds to fibroblast growth factor receptor 4 (FGFR4) with an affinity equal to or greater than FGF19 binding affinity for FGFR4; 
 (ii) activates FGFR4 to an extent or amount equal to or greater than FGF19 activates FGFR4; 
 (iii) has at least one of reduced hepatocellular carcinoma (HCC) formation; 
   greater glucose lowering activity, less lipid increasing activity, less triglyceride activity, less cholesterol activity, less non-HDL activity or less HDL increasing activity, as compared to FGF19, or as compared to an FGF19 variant sequence having any of GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) or FGDPI (SEQ ID NO:184), substituted for the WGDPI (SEQ ID NO:170) sequence at amino acids 16-20 of FGF19 (SEQ ID NO:99); and/or
 (iv) has less lean mass reducing activity as compared to FGF21; 
   thereby treating said subject.   
     
     
         74 . The method of  claim 73 , wherein the second C-terminal region sequence of the peptide comprises from 1 to 5 amino acid substitutions, deletions or insertions. 
     
     
         75 . The method of  claim 73 , wherein the peptide is less than about 250 amino acids in length. 
     
     
         76 . The method of  claim 73 , wherein the N-terminal region comprises amino acid residues DASPHVHYG (SEQ ID NO:102), or DSSPLVHYG (SEQ ID NO:103). 
     
     
         77 . The method of  claim 76 , wherein the G corresponds to the last position of the N-terminal region. 
     
     
         78 . The method of  claim 73 , wherein the N-terminal region comprises amino acid residues DSSPLLQ (SEQ ID NO:104), and wherein the Q residue is the last amino acid position of the N-terminal region. 
     
     
         79 . The method of  claim 77 , wherein the N-terminal region further comprises:
 RHPIP (SEQ ID NO:106), wherein R is the first amino acid position of the N-terminal region;   HPIP (SEQ ID NO:107), wherein H is the first amino acid position of the N-terminal region;   RPLAF (SEQ ID NO:108), wherein R is the first amino acid position of the N-terminal region;   PLAF (SEQ ID NO:109), wherein P is the first amino acid position of the N-terminal region; or   R, wherein R is the first amino acid position of the N-terminal region.   
     
     
         80 . The method of  claim 78 , wherein the N-terminal region further comprises:
 RHPIP (SEQ ID NO:106), wherein R is the first amino acid position of the N-terminal region;   HPIP (SEQ ID NO:107), wherein H is the first amino acid position of the N-terminal region;   RPLAF (SEQ ID NO:108), wherein R is the first amino acid position of the N-terminal region;   PLAF (SEQ ID NO:109), wherein P is the first amino acid position of the N-terminal region; or   R, wherein R is the first amino acid position of the N-terminal region.   
     
     
         81 . The method of  claim 73 , wherein the N-terminal region comprises amino acid residues DSSPLLQFGGQV (SEQ ID NO:105), and wherein the V residue corresponds to the last position of the N-terminal region. 
     
     
         82 . The method of  claim 73 , wherein amino acid residues HPIP (SEQ ID NO:107) are the first 4 amino acid residues of the N-terminal region. 
     
     
         83 . The method of  claim 73 , wherein
 the first position of the N-terminal region is a R or M residue;   the first and second positions of the N-terminal region is a MR, RM, RD, DS, MD or MS sequence;   the first through third positions of the N-terminal region is a MDS, RDS, MSD, MSS, or DSS sequence;   the first through fourth positions of the N-terminal region is a RDSS (SEQ ID NO:115) or MDSS (SEQ ID NO:116) sequence;   the first through fifth positions of the N-terminal region is an MRDSS (SEQ ID NO:117) sequence;   the first through sixth positions of the N-terminal region is an MDSSPL (SEQ ID NO:119) sequence; or   the first through seventh positions of the N-terminal region is an MSDSSPL (SEQ ID NO:120) sequence.   
     
     
         84 . The method of  claim 73 , wherein the peptide comprises an N-terminus region and a first C-terminal region having an amino acid sequence comprising or consisting of any of: 
       
         
           
                 
                 
               
                     
                   (amino acids 1-29 of SEQ ID NO: 1) 
                 
                     
                   RPLAFSDASPHVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 2-29 of SEQ ID NO: 1) 
                 
                     
                   PLAFSDASPHVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-29 of SEQ ID NO: 2) 
                 
                     
                   RPLAFSDSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 2-29 of SEQ ID NO: 2) 
                 
                     
                   PLAFSDSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-26 of SEQ ID NO: 8) 
                 
                     
                   RHPIPDSSPLLQWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-28 of SEQ ID NO: 9) 
                 
                     
                   RHPIPDSSPLLQFGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-27 of SEQ ID NO: 26) 
                 
                     
                   RPLAFSDSSPLVHWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 2-27 of SEQ ID NO: 26) 
                 
                     
                   PLAFSDSSPLVHWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-25 of SEQ ID NO: 47) 
                 
                     
                   HPIPDSSPLLQWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-22 of SEQ ID NO: 52) 
                 
                     
                   RDSSPLLQWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 2-22 of SEQ ID NO: 52) 
                 
                     
                   DSSPLLQWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-24 of SEQ ID NO: 53) 
                 
                     
                   MDSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-24 of SEQ ID NO: 69) 
                 
                     
                   RDSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 2-24 of SEQ ID NO: 69) 
                 
                     
                   DSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-25 of SEQ ID NO: 70) 
                 
                     
                   MRDSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                     
                 
                     
                   (amino acids 1-23 of SEQ ID NO: 141) 
                 
                     
                   DSSPLVHYGWGDPIRLRHLYTSG; 
                 
                     
                   or 
                 
                     
                     
                 
                     
                   (amino acids 1-27 of SEQ ID NO: 163) 
                 
                     
                   HPIPDSSPLLQFGWGDPIRLRHLYTSG. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
         85 . The method of  claim 73 , wherein the N-terminal region first amino acid position is a methionine (M), arginine (R), serine (S), histidine (H), proline (P), leucine (L) or aspartic acid (D) residue. 
     
     
         86 . The method of  claim 73 , wherein the N-terminal region does not have a methionine (M) or arginine (R) residue at the first amino acid position of the N-terminal region. 
     
     
         87 . The method of  claim 73 , wherein the N-terminal region comprises any one of the following amino acid sequences: MDSSPL (SEQ ID NO:119), MSDSSPL (SEQ ID NO:120), or SDSSPL (SEQ ID NO:112). 
     
     
         88 . The method of  claim 73 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:26, SEQ ID NO:47, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:69, SEQ ID NO:70; SEQ ID NO:141 or SEQ ID NO:163. 
     
     
         89 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NOs:1, 2, 8, 9, 26, 52 or 69, wherein the arginine (R) residue at the first amino acid position of the N-terminal region of the sequence is deleted. 
     
     
         90 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:1. 
     
     
         91 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:2. 
     
     
         92 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:8. 
     
     
         93 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:9. 
     
     
         94 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:26. 
     
     
         95 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:47. 
     
     
         96 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:52. 
     
     
         97 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:53. 
     
     
         98 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:141. 
     
     
         99 . The method of  claim 88 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:163. 
     
     
         100 . The method of  claim 73 , wherein the second C-terminal region sequence comprises a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD sequence (amino acids 74-78 of SEQ ID NO:188). 
     
     
         101 . The method of  claim 100 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:193. 
     
     
         102 . The method of  claim 100 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:194. 
     
     
         103 . The method of  claim 100 , wherein the peptide has an amino acid sequence comprising or consisting of SEQ ID NO:195. 
     
     
         104 . The method of  claim 73 , wherein said peptide is fused with an immunoglobulin Fc region. 
     
     
         105 . The method of  claim 73 , wherein the peptide has at least one of reduced HCC formation; greater glucose lowering activity, or less lipid increasing activity as compared to FGF19, or as compared to an FGF19 variant having any of GQV, GDI, WGPI (SEQ ID NO:171), WGDPV (SEQ ID NO:172), WGDI (SEQ ID NO:173), GDPI (SEQ ID NO:174), GPI, WGQPI (SEQ ID NO:175), WGAPI (SEQ ID NO:176), AGDPI (SEQ ID NO:177), WADPI (SEQ ID NO:178), WGDAI (SEQ ID NO:179), WGDPA (SEQ ID NO:180), WDPI (SEQ ID NO:181), WGDI (SEQ ID NO:182), WGDP (SEQ ID NO:183) or FGDPI (SEQ ID NO:184), substituted for the WGDPI (SEQ ID NO:170) sequence at amino acids 16-20 of FGF19 (SEQ ID NO:99). 
     
     
         106 . The method of  claim 105 , wherein the HCC formation, glucose lowering activity, or lipid increasing activity is ascertained in a db/db mouse. 
     
     
         107 . The method of  claim 105 , wherein the peptide has less lean mass reducing activity as compared to the lean mass reducing activity of FGF21. 
     
     
         108 . The method of  claim 105 , wherein the lean mass reducing activity is ascertained in a db/db mouse. 
     
     
         109 . The method of  claim 73 , wherein the peptide is formulated as a pharmaceutical composition further comprising a pharmaceutically acceptable carrier. 
     
     
         110 . The method of  claim 73  further comprising administration of a supplemental therapy. 
     
     
         111 . The method of  claim 73 , further comprising monitoring bilirubin levels in the subject. 
     
     
         112 . The method of  claim 73 , further comprising monitoring alkaline phosphatase (ALP) levels in the subject. 
     
     
         113 . A method of treating a subject having cirrhosis, comprising administering to the subject an effective amount of a peptide, wherein said peptide has an amino acid sequence comprising or consisting of MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSA HSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEI RPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPE DLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:70), or a sequence comprising a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD (amino acids 99-103 of SEQ ID NO:70) sequence thereof,
 thereby treating the subject.   
     
     
         114 . The method of  claim 113 , wherein the peptide has an amino acid sequence comprising SEQ ID NO:70. 
     
     
         115 . The method of  claim 113 , wherein the peptide has an amino acid sequence consisting of SEQ ID NO:70. 
     
     
         116 . The method of  claim 113 , wherein the amino acid sequence comprises EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD (amino acids 99-103 of SEQ ID NO:70) sequence of SEQ ID NO:70. 
     
     
         117 . The method of  claim 113 , wherein said peptide is fused with an immunoglobulin Fc region. 
     
     
         118 . The method of  claim 113 , wherein the peptide is formulated as a pharmaceutical composition further comprising a pharmaceutically acceptable carrier. 
     
     
         119 . The method of  claim 113 , further comprising administration of a supplemental therapy. 
     
     
         120 . The method of  claim 113 , further comprising monitoring bilirubin levels in the subject. 
     
     
         121 . The method of  claim 113 , further comprising monitoring ALP levels in the subject. 
     
     
         122 . A method of treating a subject having cirrhosis, comprising administering to the subject an effective amount of a peptide, wherein said peptide has an amino acid sequence comprising or consisting of RDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHS LLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRP DGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPED LRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK (SEQ ID NO:69), or a sequence comprising a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD (amino acids 98-102 of SEQ ID NO:69) sequence thereof,
 thereby treating the subject.   
     
     
         123 . The method of  claim 122 , wherein the peptide has an amino acid sequence comprising SEQ ID NO:69. 
     
     
         124 . The method of  claim 122 , wherein the peptide has an amino acid sequence consisting of SEQ ID NO:69. 
     
     
         125 . The method of  claim 122 , wherein the amino acid sequence comprises a EILPD (amino acids 103-107 of SEQ ID NO:193), EIRED (amino acids 103-107 of SEQ ID NO:194), EILCD (amino acids 103-107 of SEQ ID NO:195), EILED (amino acids 103-107 of SEQ ID NO:196), or LLLED (amino acids 98-102 of SEQ ID NO:100) sequence substituted for the EIRPD (amino acids 98-102 of SEQ ID NO:69) sequence of SEQ ID NO:69. 
     
     
         126 . The method of  claim 122 , wherein said peptide is fused with an immunoglobulin Fc region. 
     
     
         127 . The method of  claim 122 , wherein the peptide is formulated as a pharmaceutical composition further comprising a pharmaceutically acceptable carrier. 
     
     
         128 . The method of  claim 122 , further comprising administration a supplemental therapy. 
     
     
         129 . The method of  claim 122 , further comprising monitoring bilirubin levels in the subject. 
     
     
         130 . The method of  claim 122 , further comprising monitoring ALP levels in the subject.

Join the waitlist — get patent alerts

Track US2019175693A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.