US2016256553A1PendingUtilityA1
Variants of C-Type Natriuretic Peptide
Est. expiryMay 20, 2029(~2.8 yrs left)· nominal 20-yr term from priority
Inventors:Daniel J. WendtShinong LongSianna CastilloChristopher P. PriceMika Aoyagi-ScharberMichel Claude VellardAugustus O. Okhamafe
A61P 9/12A61P 9/10A61P 7/10A61P 9/00A61P 9/04A61P 19/00A61P 13/12A61P 19/08A61P 21/00A61K 38/22A61K 9/08A61K 47/22A61K 38/00C07K 14/58A61K 47/26A61K 47/20A61K 38/2242G01N 2333/58G01N 2800/105A61K 47/60G01N 2800/10G01N 2800/52A61K 47/10G01N 2800/385A61K 9/19C12N 15/70
54
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present disclosure provides variants of C-type natriuretic peptide (CNP), pharmaceutical compositions comprising CNP variants, and methods of making CNP variants. The CNP variants are useful as therapeutic agents for the treatment of diseases responsive to CNP, including but not limited to bone-related disorders, such as skeletal dysplasias (e.g., achondroplasia), and vascular smooth muscle disorders (e.g., restenosis and arteriosclerosis).
Claims
exact text as granted — not AI-modified1 - 49 . (canceled)
50 . A pharmaceutical composition comprising a C-type natriuretic peptide and an antioxidant, wherein the C-type natriuretic peptide consists of the amino acid sequence PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (SEQ ID NO:145).
51 . The pharmaceutical composition of claim 50 , wherein the antioxidant is methionine.
52 . The pharmaceutical composition of claim 50 , which is in liquid form.
53 . The pharmaceutical composition of claim 50 , further comprising a detergent.
54 . The pharmaceutical composition of claim 53 , wherein the detergent is polysorbate 80.
55 . The pharmaceutical composition of claim 50 , further comprising a bulking agent.
56 . The pharmaceutical composition of claim 55 , wherein the bulking agent is mannitol.
57 . The pharmaceutical composition of claim 55 , wherein the bulking agent is trehalose.
58 . The pharmaceutical composition of claim 50 , further comprising a detergent and a bulking agent.
59 . The pharmaceutical composition of claim 50 , wherein said C-type natriuretic peptide is present at a concentration of from about 0.1 mg/ml to about 20 mg/ml.Join the waitlist — get patent alerts
Track US2016256553A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.