US2016243211A1PendingUtilityA1
Vaccine comprising protein nmb0964 from neisseria meningitidis
Assignee: GLAXOSMITHKLINE BIOLOGICALS SAPriority: Sep 8, 2008Filed: Jan 7, 2016Published: Aug 25, 2016
Est. expirySep 8, 2028(~2.1 yrs left)· nominal 20-yr term from priority
Inventors:Martine Petronella BosJan PoolmanMichiel StorkJohannes Petrus Maria TommassenVincent Weynants
A61P 37/04A61P 31/04A61K 2039/55505C07K 14/22A61P 15/00A61K 39/095A61K 2039/575A61P 13/02C12P 21/00A61K 39/395A61K 38/16
41
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present invention relates to immunogenic compositions comprising neisserial blebs with upregulated levels of the NMB0964 antigens such that bactericidal antibodies are generated against said antigen. It has been found for the first time that this antigen's expression is zinc regulated and therefore methods are provided to upregulated expression through removal of the zinc repression mechanism of the cell or promoter, or through removal of zinc from the culture medium.
Claims
exact text as granted — not AI-modified1 . An immunogenic composition comprising:
(a) a Zn2+ salt; (b) a pharmaceutically acceptable excipient; and (c) a polypeptide selected from the group consisting of:
(i) a polypeptide comprising an amino acid sequence having 95% identity to the amino acid sequence RDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDIDYDNPGLSCGFHDDDNAHAHT HS (SEQ NO: 18), and
(ii) a polypeptide comprising an immunogenic fragment of 20 or more contiguous amino acids of the amino acid sequence RDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDIDYDNPGLSCGFHDDDNAHAHT HS (SEQ NO: 18).
2 . The immunogenic composition of claim 1 wherein the polypeptide comprises the amino acid sequence RDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDIDYDNPGLSCGFHDDDNAHAHT HS (SEQ NO: 18).
3 . A method of eliciting an immune response against Neisseria , said method comprising the steps of: administering to a mammal an immunologically effective amount of an immunogenic composition of claim 1 .
4 . A method of eliciting an immune response against Neisseria , said method comprising the steps of: administering to a mammal an immunologically effective amount of an immunogenic composition of claim 2 .Join the waitlist — get patent alerts
Track US2016243211A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.