US2015329637A1PendingUtilityA1
Depletion of il23r expressing cells in the treatment of various diseases
Est. expiryMay 10, 2033(~6.8 yrs left)· nominal 20-yr term from priority
A61P 9/10A61P 37/06A61P 3/10A61P 35/02A61P 35/00A61P 27/02A61P 25/28A61P 25/16A61P 29/00C07K 2317/569C07K 2317/75C07K 2317/626C07K 2317/31C07K 2317/55C07K 2317/73A61P 17/06C07K 2317/622C07K 16/2866C07K 2317/92C07K 16/2809A61P 19/02C07K 2317/33A61P 1/04A61P 25/00C07K 2317/56
42
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present invention relates, for example, to depletion of IL23R expressing cells in the treatment of disease and, in an embodiment thereof, to bispecific constructs that specifically bind to immune effector cells and, simultaneously, to IL23R-carrying target cells, as well as nucleic acids, vectors, host cells, pharmaceutical compositions, and methods of production and use thereof, including such bispecific constructs for use in, for example, treating inflammatory and/or autoimmune diseases and/or cancer.
Claims
exact text as granted — not AI-modified1 . A method for the treatment of a disease selected from the group consisting of: an inflammatory disease, an autoimmune disease and/or cancer, comprising, in a human patient in need thereof, depleting IL23R expressing cells.
2 . The method of claim 1 , wherein the patient is refractory to treatment via inhibition of IL-1β, IL-6, TGF-β, IL-23, IL-22, IL-17, IL-8, GM-CSF, G-CSF, IFN-γ and/or TNFα signaling.
3 . The method of claim 1 , wherein said patient has an inflammatory disease and/or an autoimmune disease and is refractory to treatment via inhibition of effector cytokine signaling of IL23R expressing cells and/or cytokine signaling that drives differentiation of IL23R expressing cells.
4 . The method of claim 1 , wherein the depleting comprises administering to the human patient in need thereof a bispecific construct comprising at least one first binding moiety and at least one second binding moiety, wherein said first binding moiety specifically binds to a first antigen present on a cytotoxic effector cell, and said second binding moiety specifically binds to an IL-23 receptor specific subunit (IL23R) present on the surface of a target cell, wherein said bispecific construct is administered in an effective amount for the treatment of the disease in the patient.
5 . The method of claim 4 , wherein the cytotoxic effector cell is selected from the group consisting of: a cytotoxic effector T (Tc) cell and a cytotoxic natural killer (NK) cells.
6 . The method of claim 4 , wherein said first binding moiety specifically binds to an antigen selected from CD3 and CD28.
7 . The method of claim 4 , wherein said first binding moiety specifically binds to an agonistic epitope of CD3ε.
8 . The method of claim 4 , wherein said first binding moiety and/or said second binding moiety comprises a heavy chain variable domain (V H ) or binding fragment thereof and a light chain variable domain (V L ) or binding fragment thereof.
9 . The method of claim 4 , wherein the bispecific construct is in a format selected from the group consisting of a single-chain diabody (scDb), a tandem scDb (Tandab), a linear dimeric scDb (LD-scDb), a circular dimeric scDb (CD-scDb), a bispecific T-cell engager (BiTE; tandem di-scFv), a tandem tri-scFv, a tri(a)body, bispecific Fab 2 , di-miniantibody, tetrabody, scFv-Fc-scFv fusion, di-diabody, DVD-Ig, IgG-scFab, scFab-dsscFv, Fv2-Fc, IgG-scFv fusions, including bsAb, Bs1Ab, Bs2Ab, Bs3Ab, Ts1Ab, Ts2Ab, and Knob-into-Holes (KiHs) and DuoBodies.
10 . The method of claim 1 , wherein the cancer is cancer metastasis.
11 . The method of claim 1 , wherein the cancer is selected from the group consisting of colorectal cancer, lung cancer, breast cancer, melanoma, brain cancer, nasopharyngeal cancer, oral cancer, esophageal cancer, pancreatic cancer, kidney cancer, B-cell lymphomas, and T-cell lymphomas, including adult T-cell lymphoma leukemia (ATLL), acute myeloid lymphoma (AML), diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL), pediatric acute lymphoblastic lymphoma (B-ALL), angioimmunoblastic T-cell lymphoma (AITL), anaplastic large-cell lymphoma (ALCL), T-/natural killer-cell lymphomas, and peripheral T-cell lymphoma (PTCL).
12 . The method of claim 1 , wherein the inflammatory and/or autoimmune disease is selected from the group consisting of: rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriatic arthritis, ulcerative colitis, irritable bowel disease, Crohn's disease, systemic lupus erythematosus, juvenile diabetes, autoimmune uveitis, multiple sclerosis, neuromyelitis optica/Devic's disease, Parkinson's disease, Alzheimer's disease, clinically isolated syndrome and ischemia-reperfusion injury.
13 . The method of claim 1 , wherein the treatment is in an amount to effective to treat recurrence of the inflammatory and/or autoimmune disease.
14 . The method of claim 3 , wherein the effector cytokines are IL-17, IL-22, GM-CSF, G-CSF, TNF and/or IFN-gamma.
15 . The method of claim 3 , wherein the cytokines that drive differentiation are IL-1 beta, TGF-beta, IL23, IFN-gamma and/or IL-6.
16 . The method of claim 7 , wherein the IL23R binding moiety VL is:
(SEQ ID NO: 3)
DIQMTQSPSSLSASVGDRVTITCQASENIYSFLAWYQQKPGKAPKLLIYS
ASKLAAGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTNRYSNPDIY
NVFGQGTKLTVLG;
and the IL23R binding moiety VH is:
(SEQ ID NO: 4)
EVQLVESGGGLVQPGGSLRLSCAASGIDFNSNYYMCWVRQAPGKGLEWIG
CIYVGSHVNTYYANWAKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAT
SGSSVLYFKFWGQGTLVTVSS.
17 . The method of claim 16 , wherein the CD3 binding moiety VL is:
(SEQ ID NO: 5)
DIQMTQSPSSLSASVGDRVTITCQSSESVYNNKRLSWYQQKPGKAPKLLI
YTASSLASGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQGEFTCSNAD
CFTFGQGTKLTVLG;
and the CD3 binding moiety VH is:
(SEQ ID NO: 6)
EVQLVESGGGLVQPGGSLRLSCAASGFPLSSYAMIWVRQAPGKGLEWIGM
ILRAGNIYYASWVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCARRHY
NREGYPIGIGDLWGQGTLVTVSS.Join the waitlist — get patent alerts
Track US2015329637A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.