US2014127175A1PendingUtilityA1
Glucagon analogues
Est. expiryDec 15, 2028(~2.4 yrs left)· nominal 20-yr term from priority
A61P 3/10A61P 9/00A61P 9/12A61P 9/10A61P 3/06A61P 3/00A61P 3/04A61P 29/00A61P 1/16C07K 14/605A61K 38/00
52
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The invention provides materials and methods for promoting weight loss or preventing weight gain, and in the treatment of diabetes, metabolic syndrome and associated disorders. In particular, the invention provides novel glucagon analogue peptides effective in such methods. The peptides may mediate their effect by having increased selectivity for the GLP-1 receptor as compared to human glucagon.
Claims
exact text as granted — not AI-modified1 . A nucleic acid encoding a peptide having the formula X-Z
wherein X is a peptide which has the formula I
(SEQ ID NO: 4)
His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-
Tyr-Leu-Asp-Arg-Ala-Arg-Ala-Asp-Asp-Phe-Val-Ala-
Trp-Leu-Lys-Glu-Ala
or differs from formula I at up to 4 of the following positions whereby, if different from formula I:
the residue at position 2 is selected from: Aib, D-Ser;
the residue at position 16 is: Lys, Asp, Glu;
the residue at position 18 is selected from: Lys, H is, Ala, Ser, Tyr;
the residue at position 20 is selected from: Gln, H is, Lys, Arg, Glu;
the residue at position 21 is: Glu;
the residue at position 24 is selected from: Gln, Leu, Glu, Lys, Arg, Asp;
the residue at position 27 is selected from: Met, Cys, Arg, Glu, Leu;
the residue at position 28 is selected from: Asn, Ser, Arg, Lys, Ala, Leu, Glu, Asp; and
the residue at position 29 is selected from: Thr, Glu, Lys;
and Z is absent or a sequence of 1-20 amino acid units selected from the group consisting of Ala, Leu, Ser, Thr, Tyr, Cys, Glu, Lys, Arg, Dbu, Dpr and Orn;
with the proviso that X is not His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Arg-Ala-Arg-Ala-Asp-Asp-Phe-Val-Ala-Trp-Leu-Lys-Ser-Thr (SEQ ID NO:5).
2 . The nucleic acid according to claim 1 , wherein X differs from formula I at up to 4 of the following positions whereby, if different from formula I:
the residue at position 2 is selected from: Aib, D-Ser; the residue at position 18 is selected from: Lys, H is, Ala, Ser, Tyr; the residue at position 20 is selected from: Gln, H is, Lys, Arg, Glu; the residue at position 24 is selected from: Gln, Leu, Glu, Lys, Arg; the residue at position 27 is selected from: Met, Cys, Arg, Glu, Leu; the residue at position 28 is selected from: Asn, Ser, Arg, Lys, Ala, Leu; and the residue at position 29 is selected from: Thr, Glu, Lys.
3 . The nucleic acid according to claim 2 , comprising the residues 27-Lys and 28-Ser.
4 . The nucleic acid according to claim 3 , wherein X additionally differs from formula I at one or two of the following positions whereby, if different from formula I:
the residue at position 2 is selected from: Aib, D-Ser; the residue at position 18 is selected from: Lys, H is, Ala, Ser, Tyr; the residue at position 20 is selected from: Gln, H is, Lys, Arg, Glu; the residue at position 24 is selected from: Gln, Leu, Glu, Lys, Arg; and the residue at position 29 is selected from: Thr, Glu, Lys.
5 . The nucleic acid according to claim 1 , wherein the residues at positions 16 and 20 are capable of forming a salt bridge.
6 . The nucleic acid according to claim 5 , comprising the residues 16-Arg, 20-Asp.
7 . The nucleic acid according to claim 1 , wherein X comprises one or more of the following sets of residues:
16-Arg; 16-Arg, 20-Asp; 16-Arg, 20-Asp, 24-Ala; 16-Arg, 20-Asp, 27-Lys, 28-Ser; 16-Arg, 20-Asp, 29-Ala; 16-Arg, 27-Lys, 28-Ser; 16-Arg, 27-Lys, 28-Ser, 29-Ala; 24-Ala, 27-Lys, 28-Ser; 24-Ala, 27-Lys, 28-Ser, 29-Ala; 24-Ala; 27-Lys; 28-Ser; 20-Glu, 28-Ser, 29-Thr; 24-Glu, 28-Ser, 29-Thr; 27-Glu, 28-Arg; 2-D-Ser, 28-Ser, 29-Thr; or 20-His, 28-Ser, 29-Thr.
8 . The nucleic acid according to claim 1 , wherein X has the sequence:
(SEQ ID NO: 6)
HSQGTFTSDYSKYLDRARADDFVAWLKSA;
(SEQ ID NO: 7)
HSQGTFTSDYSKYLDRARADDFVAWLKEA;
(SEQ ID NO: 8)
HSQGTFTSDYSKYLDRARAEDFVAWLKST;
(SEQ ID NO: 9)
HSQGTFTSDYSKYLDRARADDFVEWLKST;
(SEQ ID NO: 10)
HSQGTFTSDYSKYLDRARADDFVAWLERA;
(SEQ ID NO: 11)
H-D-Ser-QGTFTSDYSKYLDRARADDFVAWLKST;
or
(SEQ ID NO: 12)
HSQGTFTSDYSKYLDRARAHDFVAWLKST.
9 . The nucleic acid according to claim 1 , wherein Z has no more than 25% sequence identity with the corresponding portion of the IP-1 sequence of human oxyntomodulin having the sequence Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala (SEQ ID NO:2).
10 . The nucleic acid according to claim 1 , wherein Z has a Cys as the C-terminal residue.
11 . The nucleic acid according to claim 1 , wherein Z is absent.
12 . An expression vector comprising the nucleic acid according to claim 1 .
13 . A host cell comprising the nucleic acid according to claim 1 .
14 . A host cell comprising the expression vector according to claim 12 .
15 . A pharmaceutical composition comprising the nucleic acid according to claim 1 , in admixture with a pharmaceutically acceptable carrier.
16 . A pharmaceutical composition comprising the expression vector according to claim 12 , in admixture with a pharmaceutically acceptable carrier.
17 . A pharmaceutical composition comprising the host cell according to claim 13 , in admixture with a pharmaceutically acceptable carrier.
18 . A pharmaceutical composition comprising the host cell according to claim 14 , in admixture with a pharmaceutically acceptable carrier.
19 . A method of reducing weight gain, promoting weight loss, or for treatment of a condition caused by or associated with excess body weight or obesity including morbid obesity, obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea, or for treatment of insulin resistance, glucose intolerance, type 2 diabetes, hypertension, atherogenic dyslipidimia, atherosclerois, arteriosclerosis, coronary heart disease or stroke in a subject in need thereof, said method comprising administering the nucleic acid according to claim 1 to said subject.
20 . A method of reducing weight gain, promoting weight loss, or for treatment of a condition caused by or associated with excess body weight or obesity including morbid obesity, obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea, or for treatment of insulin resistance, glucose intolerance, type 2 diabetes, hypertension, atherogenic dyslipidimia, atherosclerois, arteriosclerosis, coronary heart disease or stroke in a subject in need thereof, said method comprising administering the expression vector according to claim 12 to said subject.
21 . A method of reducing weight gain, promoting weight loss, or for treatment of a condition caused by or associated with excess body weight or obesity including morbid obesity, obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea, or for treatment of insulin resistance, glucose intolerance, type 2 diabetes, hypertension, atherogenic dyslipidimia, atherosclerois, arteriosclerosis, coronary heart disease or stroke in a subject in need thereof, said method comprising administering the host cell according to claim 13 to said subject.
22 . A method of reducing weight gain, promoting weight loss, or for treatment of a condition caused by or associated with excess body weight or obesity including morbid obesity, obesity linked inflammation, obesity linked gallbladder disease and obesity induced sleep apnea, or for treatment of insulin resistance, glucose intolerance, type 2 diabetes, hypertension, atherogenic dyslipidimia, atherosclerois, arteriosclerosis, coronary heart disease or stroke in a subject in need thereof, said method comprising administering the host cell according to claim 14 to said subject.Join the waitlist — get patent alerts
Track US2014127175A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.