US2013129735A1PendingUtilityA1
Antibodies to egfl7 and methods for their use
Est. expiryMar 16, 2026(expired)· nominal 20-yr term from priority
A61P 35/04A61P 9/10A61P 35/00A61P 43/00A61P 37/06A61P 9/00A61P 27/00A61P 27/02A61P 27/06C07K 2317/73A61P 19/02C07K 2317/565A61K 2039/505A61K 2039/507A61P 17/06C07K 2317/56C07K 16/22
54
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The invention provides anti-EGFL7 antibodies, and compositions comprising and methods of using these antibodies.
Claims
exact text as granted — not AI-modifiedWhat is claimed is:
1 . An antibody produced by a hybridoma selected from the group consisting of: anti-EGFL7 mumab 4F11.1.8, anti-EGFL7 mumab 10G9.1.6, and anti-EGFL7 mumab 18F7.1.8.
2 . An anti-EGFL7 antibody comprising one or more complementarity determining regions (CDRs) selected from the group consisting of:
(SEQ ID NO: 5)
(a) 4F11 CDR-L1 sequence KASQSVDYDGDSYMS;
(SEQ ID NO: 6)
(b) 4F11 CDR-L2 sequence GASNLES;
(SEQ ID NO: 7)
(c) 4F11 CDR-L3 sequence QQNNEDPYT;
(SEQ ID NO: 8)
(d) 4F11 CDR-H1 sequence TYGMS;
(SEQ ID NO: 9)
(e) 4F11 CDR-H2 sequence WINTHSGVPTYADDFKG;
and
(SEQ ID NO: 10)
(f) 4F11 CDR-H3 sequence LGSSA.
3 . The anti-EGFL7 antibody of claim 2 , wherein the light chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: KASQSVDYDGDSYMS (SEQ ID NO: 5), GASNLES (SEQ ID NO: 6), and QQNNEDPYT (SEQ ID NO: 7).
4 . The anti-EGFL7 antibody of claim 2 , wherein the heavy chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: TYGMS (SEQ ID NO: 8), WINTHSGVPTYADDFKG (SEQ ID NO: 9), and LGSSA (SEQ ID NO: 10).
5 . The anti-EGFL7 antibody of claim 2 , wherein the light chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: KASQSVDYDGDSYMS (SEQ ID NO: 5), GASNLES (SEQ ID NO: 6), and QQNNEDPYT (SEQ ID NO: 7); and
wherein the heavy chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: TYGMS (SEQ ID NO: 8), WINTHSGVPTYADDFKG (SEQ ID NO: 9), and LGSSA (SEQ ID NO: 10).
6 . The anti-EGFL7 antibody of claim 2 , wherein the light chain of said antibody comprises the sequence:
(SEQ ID NO: 1)
DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMSWYQQKPGQPPKL
LIYGASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQNNEDPY
TFGGGTKVEIKR.
7 . The anti-EGFL7 antibody of claim 2 , wherein the heavy chain of said antibody comprises the sequence:
(SEQ ID NO: 2)
QIQLVQSGPELKKPGETVKISCKASGHTFTTYGMSWVKQAPGKGLKWMGW
INTHSGVPTYADDFKGRFAFSLETSASTAHLQINNLKNEDTATYFCARLG
SSAVDYWGQGTTVTVSS.
8 . An anti-EGFL7 antibody comprising one or more complementarity determining regions (CDRs) selected from the group consisting of:
(SEQ ID NO: 11)
(a) 10G9 CDR-L1 sequence RSSQSLVHTNGITYLH;
(SEQ ID NO: 12)
(b) 10G9 CDR-L2 sequence KVSNRFS;
(SEQ ID NO: 13)
(c) 10G9 CDR-L3 sequence SQSTHVPLT;
(SEQ ID NO: 14)
(d) 10G9 CDR-H1 sequence DYYMNSDYYMN;
(SEQ ID NO: 15)
(e) 10G9 CDR-H2 sequence DINPKNGGTTYNQKFKG;
and
(SEQ ID NO: 16)
(f) 10G9 CDR-H3 sequence ALGVFDY.
9 . The anti-EGFL7 antibody of claim 8 , wherein the light chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: RSSQSLVHTNGITYLH (SEQ ID NO: 11), KVSNRFS (SEQ ID NO: 12), and SQSTHVPLT (SEQ ID NO: 13).
10 . The anti-EGFL7 antibody of claim 8 , wherein the heavy chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: DYYMNSDYYMN (SEQ ID NO: 14), DINPKNGGTTYNQKFKG (SEQ ID NO: 15), and ALGVFDY (SEQ ID NO: 16).
11 . The anti-EGFL7 antibody of claim 8 , wherein the light chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: RSSQSLVHTNGITYLH (SEQ ID NO: 11), KVSNRFS (SEQ ID NO: 12), and SQSTHVPLT (SEQ ID NO: 13); and
wherein the heavy chain of said antibody comprises at least one, at least two or all three of the CDR sequences selected from: DYYMNSDYYMN (SEQ ID NO: 14), DINPKNGGTTYNQKFKG (SEQ ID NO: 15), and ALGVFDY (SEQ ID NO: 16).
12 . The anti-EGFL7 antibody of claim 8 , wherein the light chain of said antibody comprises the sequence:
(SEQ ID NO: 3)
DIVMTQTPLSLPVSLGDQASISCRSSQSLVHTNGITYLHWYLQKPGQSPK
LLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVP
LTFGAGTKVEIKR.
13 . The anti-EGFL7 antibody of claim 8 , wherein the heavy chain of said antibody comprises the sequence:
(SEQ ID NO: 4)
EVQLQQSGPELVKPGASVKISCKASGYTFSDYYMNSDYYMNWVKQSHGKS
LEWIGDINPKNGGTTYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVY
YCAREADYDPIYYAMDYWGQGTTLTVSA.
14 . An anti-EGFL7 antibody that specifically binds to a polypeptide comprising an amino acid sequence selected from the group consisting of: CCP, RTIY (SEQ ID NO 33).
15 . An isolated antibody that binds to the same epitope on human EGFL7 as the antibody of any one of claims 1 to 14 .
16 . An isolated antibody that competes for EGFL7 binding with the antibody of any one of claims 1 to 14 .
17 . The antibody of any one of claims 1 to 16 , wherein the antibody is a monoclonal antibody.
18 . The antibody of any one of claims 1 to 17 , wherein the antibody is selected from the group consisting of a chimeric antibody, a humanized antibody, an affinity matured antibody, a human antibody, and a bispecific antibody.
19 . The antibody of any one of claims 1 to 18 , wherein the antibody is an antibody fragment.
20 . A pharmaceutical composition comprising an anti-EGFL7 antibody of any of claims 1 to 19 .
21 . The pharmaceutical composition of claim 20 , further comprising and anti-angiogenic agent.
22 . The pharmaceutical composition of claim 21 , wherein the anti-angiogenic agent is selected from the group consisting of bevacizumab and ranibizumab.
23 . A polynucleotide encoding an antibody of any of claims 1 to 19 .
24 . A vector comprising the polynucleotide of claim 23 .
25 . The vector of claim 24 , wherein the vector is an expression vector.
26 . A host cell comprising a vector of claim 24 or 25 .
27 . The host cell of claim 26 , wherein the host cell is prokaryotic.
28 . The host cell of claim 26 , wherein the host cell is eukaryotic.
29 . The host cell of claim 26 , wherein the host cell is mammalian.
30 . A method for making an anti-EGFL7 antibody, said method comprising (a) expressing a vector of claim 25 in a suitable host cell, and (b) recovering the antibody.
31 . The method of claim 30 , wherein the host cell is prokaryotic.
32 . The method of claim 30 , wherein the host cell is eukaryotic.
33 . A method for reducing or inhibiting angiogenesis in a subject having a pathological condition associated with angiogenesis, comprising administering to the subject an effective amount of the anti-EGFL7 antibody of any one of claims 1 to 19 or the pharmaceutical composition of claim 20 .
34 . The method of claim 33 , wherein the pathological condition is a neoplasm.
35 . The method of claim 34 , wherein the neoplasm is a carcinoma.
36 . The method of claim 33 , wherein the pathological condition is associated with the eye.
37 . The method of claim 36 , wherein the pathological condition is an intraocular neovascular disease.
38 . The method of any one of claims 33 to 35 , further comprising administering to the subject an anti-angiogenic agent.
39 . The method of claim 38 , wherein the anti-angiogenic agent is an antagonist of vascular endothelial growth factor (VEGF).
40 . The method of claim 39 , wherein the antagonist is an anti-VEGF antibody.
41 . The method of claim 40 , wherein the anti-VEGF antibody is bevacizumab.
42 . The method of claim 36 or 37 , further comprising administering to the subject an anti-angiogenic agent.
43 . The method of claim 42 , wherein the anti-angiogenic agent is an antagonist of vascular endothelial growth factor (VEGF).
44 . The method of claim 43 , wherein the antagonist is an anti-VEGF antibody.
45 . The method of claim 44 , wherein the anti-VEGF antibody is ranibizumab.
46 . The method of any one of claims 38 to 45 , wherein the anti-angiogenic agent is administered prior to or subsequent to the administration of the anti-EGFL7 antibody.
47 . The method of any one of claims 38 to 45 , wherein the anti-angiogenic agent is administered concurrently with the anti-EGFL7 antibody.
48 . A method of enhancing the efficacy of an anti-angiogenic agent in a subject having a pathological condition associated with angiogenesis, comprising administering to the subject the antibody of any one of claims 1 to 19 or the pharmaceutical composition of claim 20 or 21 .
49 . The method of claim 38 , wherein the pathological condition is a neoplasm.
50 . The method of claim 39 , wherein the neoplasm is a carcinoma.
51 . The method of any one of claims 48 to 50 , wherein the anti-antigenic agent is bevacizumab.
52 . The method of any one of claims 48 to 51 , further comprising administering a chemotherapeutic agent.
53 . The method of claim 48 , wherein the pathological condition is associated with the eye.
54 . The method of claim 53 , wherein the pathological condition is an intraocular neovascular disease.
55 . The method of claim 53 or 54 , wherein the anti-angiogenic agent is ranibizumab.
56 . The method of any one of claims 53 to 55 , further comprising administering a corticosteroid.
57 . The method of any one of claims 53 to 55 , further comprising administering photodynamic therapy.Join the waitlist — get patent alerts
Track US2013129735A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.