US2011086372A1PendingUtilityA1

Biomarkers associated with nephropathy

Assignee: IND TECHNOLOGY RES INST ITRIPriority: Jan 28, 2009Filed: Dec 20, 2010Published: Apr 14, 2011
Est. expiryJan 28, 2029(~2.5 yrs left)· nominal 20-yr term from priority
G01N 33/6893C07K 14/70503G01N 2333/4728G01N 2333/70503G01N 2800/347G01N 2800/52G01N 2800/56C07K 16/2803
51
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

Use of urine biomarkers for diagnosing nephropathy, monitoring nephropathy progress, and assessing efficacy of a nephropathy treatment. These urine biomarkers include leukocyte-associated Ig-like receptor-2, alpha-1 acid glycoprotein, their fragments, and combinations thereof.

Claims

exact text as granted — not AI-modified
1 . An isolated antibody specifically binding to DFLELLVKGTVPGTEASGFDAP, or GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         2 . The antibody of  claim 1 , specifically binding to DFLELLVKGTVPGTEASGFDAP. 
     
     
         3 . The antibody of  claim 1 , specifically binding to GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         4 . The antibody of  claim 1 , wherein the antibody is a monoclonal antibody. 
     
     
         5 . The antibody of  claim 1 , wherein the antibody is a whole immunoglobulin molecule. 
     
     
         6 . The antibody of  claim 1 , wherein the antibody is a single-chain antibody, a chimeric antibody, or a humanized antibody. 
     
     
         7 . A kit for diagnosing nephropathy, comprising a first antibody specifically binding to leukocyte-associated Ig-like receptor-2 and a second antibody specifically binding to alpha-1 acid glycoprotein. 
     
     
         8 . The kit of  claim 7 , wherein the first and second antibodies are whole immunoglobulin molecules. 
     
     
         9 . The kit of  claim 7 , wherein the first and second antibodies are monoclonal antibodies. 
     
     
         10 . The kit of  claim 7 , wherein the first antibody specifically binds to DFLELLVKGTVPGTEASGFDAP. 
     
     
         11 . The kit of  claim 7 , wherein the second antibody specifically binds to GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         12 . The kit of  claim 7 , wherein the first antibody specifically binds to DFLELLVKGTVPGTEASGFDAP, and the second antibody specifically binds to GQEHFAHLLILRDTKTYMLAFDVNDEKNWGLS. 
     
     
         13 . The kit of  claim 7 , consisting essentially of the first antibody and the second antibody. 
     
     
         14 . The kit of  claim 7 , further comprising reagents and materials for an immunoassay, the immunoassay being ELISA, Westernblot, RIA, FIA or LIA.

Join the waitlist — get patent alerts

Track US2011086372A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.