US2011020323A1PendingUtilityA1
Gram-positive bacteria specific binding compounds
Est. expiryJul 15, 2029(~3 yrs left)· nominal 20-yr term from priority
Inventors:Tim BeaumontMark Jeroen KwakkenbosEric J. BrownJohn Hiroshi MorisakiWouter HazenbosSanjeev MariathasanKimberly KajiharaYi Xia
A61P 31/00A61P 37/04A61P 31/04A61P 37/06C07K 2317/567C07K 2317/56C07K 16/1278C07K 2317/52G01N 33/5091C07K 16/1271C07K 2317/21G01N 33/6893G01N 33/6854C07K 2317/565G01N 2469/10G01N 2800/26A61K 39/395A61K 47/42A61K 38/18C07K 14/475C07K 16/28C07K 16/22A61K 39/00A61K 48/00C07K 16/12
56
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
The present invention provides improved binding compounds capable of specifically binding Gram-positive bacteria. Binding compounds are provided that are fully human, enabling therapeutic applications in human individuals.
Claims
exact text as granted — not AI-modified1 . An antibody or functional part thereof or immunoglobulin chain or functional equivalent thereof, which comprises:
(a) a heavy chain CDR1 sequence comprising a sequence which has at least 70% sequence identity to the sequence RFAMS (SEQ ID NO:1), and/or (b) a heavy chain CDR2 sequence comprising a sequence which has at least 70% sequence identity to the sequence SINNGNNPYYARSVQY (SEQ ID NO:2), and/or (c) a heavy chain CDR3 sequence comprising a sequence which has at least 70% sequence identity to the sequence DHPSSGWPTFDS (SEQ ID NO:3), and/or (d) a light chain CDR1 sequence comprising a sequence which has at least 70% sequence identity to the sequence RASENVGDWLA (SEQ ID NO:4), and/or (e) a light chain CDR2 sequence comprising a sequence which has at least 70% sequence identity to the sequence KTSILES (SEQ ID NO:5), and/or (f) a light chain CDR3 sequence comprising a sequence which has at least 70% sequence identity to the sequence QHYXRFPYT(SEQ ID NO:6), wherein X is I or M.
2 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , having a heavy chain sequence comprising a sequence which has at least 70% sequence identity to the sequence EVQLLESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARSV QYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:7) and/or having a light chain sequence which has at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKLEIKRTV, wherein X is I of M (SEQ ID NO:8).
3 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , having a heavy chain sequence comprising a sequence which has at least 70% sequence identity to the sequence EVQLLESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARSV QYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:7) and/or having a light chain sequence which has at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKLEIKRA, wherein X is I of M (SEQ ID NO:10).
4 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , having a heavy chain sequence comprising a sequence which has at least 70% sequence identity to the sequence EVQLLESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARSV QYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:7) and/or having a light chain sequence which has at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKVEIKRTV, wherein X is I of M (SEQ ID NO:11).
5 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , having a heavy chain sequence comprising a sequence which has at least 70% sequence identity to the sequence EVQLVESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARS VQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:9) and/or having a light chain sequence which has at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKLEIKRTV, wherein X is I of M (SEQ ID NO:8).
6 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , having a heavy chain sequence comprising a sequence which has at least 70% sequence identity to the sequence EVQLVESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARS VQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:9) and/or having a light chain sequence which has at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKLEIKRA, wherein X is I of M (SEQ ID NO:10).
7 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , having a heavy chain sequence comprising a sequence which has at least 70% sequence identity to the sequence EVQLVESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARS VQYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:9) and/or having a light chain sequence which has at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKVEIKRTV, wherein X is I of M (SEQ ID NO:11).
8 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , wherein an asparagine has been replaced by another amino acid.
9 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 8 , wherein said asparagine is an asparagine at position 53 of the heavy chain, whereby the amino acid numbering is according to Kabat (1991).
10 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 9 , wherein said other amino acid is serine.
11 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , wherein at least one amino acid other than cysteine has been replaced with cysteine.
12 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 11 , wherein said at least one amino acid other than cysteine is valine at light chain position 205 and/or valine at light chain position 110, and/or alanine at heavy chain position 114, whereby the amino acid numbering is according to Kabat (1991).
13 . The antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 , which is a human antibody.
14 . An isolated antibody that binds to in vivo-grown S. aureus.
15 . The antibody of claim 14 , wherein said antibody is human.
16 . An antibody or functional part or immunoglobulin chain or functional equivalent capable of binding an SD-repeat dependent epitope.
17 . An antibody or functional part or immunoglobulin chain or functional equivalent capable of binding to S. aureus ClfA, ClfB, SdrC, SdrD and SdrE.
18 . An antibody or functional part or immunoglobulin chain or functional equivalent which is capable of competing with the antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 for binding to a Staphylococcus species.
19 . An isolated, synthetic or recombinant nucleic acid sequence with a length of at least 15 nucleotides, or a functional equivalent thereof, encoding at least one CDR sequence of the antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 .
20 . An isolated, synthetic or recombinant nucleic acid sequence, or a functional equivalent thereof, comprising a sequence which has at least 70% sequence identity to a sequence selected from the group consisting of cgctttgccatgagc (SEQ ID NO:12), tcgatcaataatgggaataacccatactacgcacggtcggtacaatac (SEQ ID NO:13), gatcaccctagtagtggctggcccacctttgactcc (SEQ ID NO:14), cgggccagtgaaaacgttggtgactggttggcc (SEQ ID NO:15), aagacatctattctagaaagt (SEQ ID NO:16) and caacactatatacgtttcccgtacact (SEQ ID NO:17).
21 . The nucleic acid sequence or functional equivalent according to claim 20 , wherein said nucleic acid sequence or functional equivalent comprises a sequence which has at least 70% sequence identity to at least part of a nucleotide sequence as depicted in FIG. 1 , said part having at least 15 nucleotides and encoding at least one CDR region.
22 . An isolated, synthetic or recombinant nucleic acid sequence, or a functional equivalent thereof, comprising a sequence encoding an amino acid sequence which has at least 70% sequence identity to the sequence RFAMS (SEQ ID NO:1), and/or at least 70% sequence identity to the sequence SINNGNNPYYARSVQY (SEQ ID NO:2), and/or at least 70% sequence identity to the sequence DHPSSGWPTFDS (SEQ ID NO:3), and/or at least 70% sequence identity to the sequence RASENVGDWLA (SEQ ID NO:4), and/or at least 70% sequence identity to the sequence KTSILES (SEQ ID NO:5), and/or at least 70% sequence identity to the sequence QHYXRFPYT, wherein X is I or M (SEQ ID NO:6), and/or at least 70% sequence identity to the sequence EVQLLESGGGLVQPGGSLRLSCAASGFTLSRFAMSWVRQAPGRGLEWVASINNGNNPYYARSV QYRFTVSRDVSQNTVSLQMNNLRAEDSATYFCAKDHPSSGWPTFDSWGPGTLVTVSS (SEQ ID NO:7), and/or at least 70% sequence identity to the sequence DIQLTQSPSALPASVGDRVSITCRASENVGDWLAWYRQKPGKAPNLLIYKTSILESGVPSRFSGS GSGTEFTLTISSLQPDDFATYYCQHYXRFPYTFGQGTKLEIKRTV, wherein X is I or M (SEQ ID NO:8).
23 . Methods of treating and/or preventing a Gram-positive bacterium-related disorder comprising administering an effective amount of the antibody or functional part or the immunoglobulin chain or functional equivalent thereof according to claim 1 .
24 . A pharmaceutical composition comprising the antibody or functional part or the immunoglobulin chain or functional equivalent thereof according to claim 1 and a pharmaceutical acceptable carrier, diluent or excipient.
25 . An isolated or recombinant antibody producing cell capable of producing the antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 .
26 . A method for producing the antibody or functional part or immunoglobulin chain or functional equivalent according to claim 1 .
27 . The method according to claim 26 , further comprising harvesting, purifying and/or isolating the antibody or functional part or immunoglobulin chain or functional equivalent.
28 . A method for diagnosing a Staphylococcus infection comprising contacting a sample with the antibody or functional part or the immunoglobulin chain or functional equivalent thereof according to claim 1 .
29 . A method for detecting S. aureus and/or S. epidermidi comprising contacting a sample with the antibody or functional part or an immunoglobulin chain or functional equivalent thereof according to claim 1 .
30 . A method for isolating S. aureus and/or S. epidermidis bacteria comprising contacting a sample with the antibody or functional part or the immunoglobulin chain or functional equivalent thereof according to claim 1 .Join the waitlist — get patent alerts
Track US2011020323A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.