US2010221267A1PendingUtilityA1

Pdgfr beta-specific inhibitors

Assignee: IMCLONE LLCPriority: Apr 17, 2007Filed: Apr 21, 2010Published: Sep 2, 2010
Est. expiryApr 17, 2027(~0.7 yrs left)· nominal 20-yr term from priority
A61P 35/04A61K 39/3955A61K 2039/505C07K 2317/76C07K 2317/55C07K 2317/21C07K 2317/73C07K 2317/92A61P 35/00C07K 2317/565C07K 2317/56A61K 2039/507A61K 41/00A61K 45/06C07K 16/2863C07K 16/28A61K 39/395C12N 15/63
46
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The invention is directed to novel PDGFRβ-specific antagonists. The antagonists include antibodies, which can be bispecific. The antibodies are used to reduce or inhibit tumor growth and or to treat an angiogenic disease. The invention also includes combinations of PDGFRβ-specific antagonists with VEGFR antagonists for such treatments. The antagonists can further be administered in combination with other anti-angiogenic or anti-neoplastic drugs.

Claims

exact text as granted — not AI-modified
1 .- 18 . (canceled) 
     
     
         19 . A method of reducing tumor growth in a patient comprising administering to the patient an effective amount of the antibody, or fragment thereof that binds human PDGFRβ, comprising SYAIS (SEQ ID NO:20) at CDRH1; RIIPILGIANYAQKFQG (SEQ ID NO:22) at CDRH2; DMGSRNYYYFY (SEQ ID NO:24) at CDRH3; RASQSVGRYLA (SEQ ID NO:28) at CDRL1; GASNRAT (SEQ ID NO:30) at CDRL2; and QQRSNWPLT (SEQ ID NO:32) at CDRL3. 
     
     
         20 .- 32 . (canceled) 
     
     
         33 . The method of  claim 19 , wherein the tumor growth is in ovarian or lung tumors. 
     
     
         34 . A method of reducing tumor growth in a patient comprising administering to the patient an effective amount of the antibody, or fragment thereof that binds human PDGFRβ, comprising a VL comprising the amino acid sequence: 
       
         
           
                 
               
                   (SEQ ID NO: 26) 
                 
                 
               
                   EIVLTQSPATLSLSPGERATLSCRASQSVGRYLAWYQQKPGQAPRILIYG 
                 
                     
                 
                   ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGG 
                 
                     
                 
                   GTKVEIK, 
                 
             
                
               
            
             
                
                
                
                
                
               
            
           
         
       
       and a VH comprising the amino acid sequence: 
       
         
           
                 
               
                   (SEQ ID NO: 18) 
                 
                 
               
                   QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGR 
                 
                     
                 
                   IIPILGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARDM 
                 
                     
                 
                   GSRNYYYFYWGQGTLVTVSS. 
                 
             
                
               
            
             
                
                
                
                
                
               
            
           
         
       
     
     
         35 . The method of  claim 34 , wherein the tumor growth is in ovarian or lung tumors.

Join the waitlist — get patent alerts

Track US2010221267A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.