Insulin production methods and pro-insulin constructs
Abstract
Novel pro-insulin having specific amino acid and/or nucleic acid modifications suitable for improved methods of insulin production are provided. Novel and highly efficient processes for preparing the pro-insulin preparations and preparations containing them are also disclosed. The novel pro-insulin preparations may be converted into human insulin useful in therapeutic preparations. Novel peptides of the C-peptide, and N terminus, including RREAEALQVGQVELGGGPGAGSLQPLALEGSLQAR (SEQ ID NO:32), and MHHHHHHGGR (SEQ ID NO:36) respectively are provided, as well as the unique nucleic acid molecules encoding them.
Claims
exact text as granted — not AI-modified1 . A nucleic acid sequence encoding a polypeptide comprising the sequence A-RREAEALQVGQVELGGGPGAGSLQPLALEGSLQAR (SEQ ID NO:32)-B, wherein said A chain and said B chain are native human insulin chains.
2 . A nucleic acid sequence encoding the polypeptide
RREAEALQVGQVELGGGPGAGSLQPLALEGSLQA
(SEQ ID NG:32)
R.
3 . An expression vector comprising the nucleic acid sequence of claim 1 .
4 . The expression vector of claim 3 , wherein the expression vector is Pro-insulin (His Tagged)/K64A/pTrcHis2A(Kan),His:tagged-Gly-Gly-Arg/Pro-insulin/(Kan).
5 . A microorganism transformed with the vector of claim 4 .
6 . The microorganism of claim 5 further defined as an E. coli transformed with plasmid Pro-Insulin (His Tagged)/K64A/pTcHis2A(Kan) plasmid.
7 . An amino acid sequence comprising
RREAEALQVGQVELGGGPGAGSLQPLALEGSLQA
(SEQ ID NG:32)
R.
8 . A composition enriched for a peptide encoded by the amino acid sequence of claim 7 .
9 . A process for preparing a composition enriched for an insulin analog employing a modified human pro-insulin peptide comprising:
(a) preparing an isolated nucleic acid sequence encoding native human pro-insulin; (b) modifying said nucleic acid sequence by providing a molecular tag on said modified pro-insulin sequence so as to provide a histidine-tagged modified pro-insulin peptide; (c) converting a lysine residue to an alanine residue at position 64 in a C-peptide region of said pro-insulin sequence to provide a modified pro-insulin derivative gene sequence; (d) inserting the modified pro-insulin derivative gene sequence into a suitable vector to provide a vector comprising said modified pro-insulin derivative gene sequence; (e) transfecting a culture of competent cells comprising E. coli cells with said vector to provide transformed E. coli cells; (f) culturing the transformed E. coli cells under conditions suitable for expression of the modified pro-insulin derivative gene sequence; (g) disrupting said population of transformed E. coli cells to provide a composition comprising inclusion bodies containing the modified human pro-insulin; (h) solubilizing said composition to provide a composition comprising unfolded peptide; (i) refolding said unfolded peptide to provide refolded human pro-insulin derivative peptide; (j) passing said composition over a metal chelating column (Nickel chelate) to purify said composition and collecting a purified preparation of said refolded human pro-insulin derivative peptide; (k) transforming the collected purified preparation of refolded human pro-insulin derivative peptide into Arg and Di-Arg peptide species by tryptic digestion; (l) purifying said Arg and Di-Arg peptide species by passing said peptides through a reverse phase column; and (m) transforming the purified Arg and Di-Arg peptide species into insulin by carboxypeptidase B digestion and harvesting an insulin analog.
10 . The process of claim 9 wherein the E. coli is a BL21 production E. coli.
11 . The process of claim 9 wherein the peptide is further defined as comprising an amino acid sequence encoding a substituted human pro-insulin derivative protein having an amino acid sequence comprising:
(SEQ ID NO: 30)
MHHHHHHGGRFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVG
QVELGGGPGAGSLQPLALEGSLQARGIVEGCCTSICSLYGLENYCN.
12 . The process of claim 9 wherein the reverse phase chromatography column is further defined as comprising a silica based media with a C4, C8, or C18 bonded phase.
13 . The process of claim 9 wherein the suitable vector is a pTrcHis2A (Kan) vector.
14 . A pharmaceutical product comprising recombinant human insulin prepared by the process of claim 9 .
15 . A process for preparing a human pro-insulin derivative comprising a C-peptide RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQAR (SEQ ID NO:33), said process comprising:
(a) preparing a pro-insulin peptide having a C-peptide amino acid sequence
RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQA
(SEQ ID NG:33)
R;
(b) modifying said peptide to include a met-histidine-Gly-Gly-Arg tag at the N-terminus of said peptide;
(c) incorporating said nucleic acid sequence into an appropriate vector to provide a transformed vector; (pTrcHis vector);
(d) transforming a population of competent cells comprising E. coli cells with said vector to provide transformed E. coli cells;
(e) selecting transformed E. coli cells that express a peptide comprising an amino acid sequence -RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQAR (SEQ ID NO:33);
(f) culturing a composition of said selected transformed cells under conditions suitable for expression of the peptide having said amino acid sequence;
(g) solubilizing said composition comprising said cells; and
(h) purifying the human pro-insulin derivative from the culture.
16 . The process of claim 15 further comprising the step:
(i) crystallizing the human pro-insulin derivative.
17 . The process of claim 15 further comprising preparing human insulin from the human pro-insulin derivative by enzymatic hydrolysis.
18 . The process of claim 15 wherein the E. coli is a BL21 production E. coli.
19 . A composition prepared by the process of claim 17 , wherein said composition is essentially free of human pro-insulin.Join the waitlist — get patent alerts
Track US2010210815A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.