US2009324604A1PendingUtilityA1
M-csf specific monoclonal antibody and uses thereof
Est. expiryJan 7, 2024(expired)· nominal 20-yr term from priority
Inventors:Cheng LiuDeborah Lee ZimmermanGregory Martin HarroweKirston E. KothsWilliam Michael KavanaughLi LongArnold HorwitzMaria Calderon-Cacia
A61P 5/14A61P 35/00A61P 43/00A61P 5/00A61P 35/02A61P 35/04A61P 3/02A61P 3/14A61P 29/00A61P 3/00A61P 19/10A61P 1/02A61P 13/12A61P 19/08A61P 19/00A61P 1/16A61P 19/02A61K 45/06C07K 2317/76A61K 39/39558C07K 2317/565C07K 16/243A61K 31/663C07K 2317/56C07K 2317/34A61K 31/675C07K 2317/24C07K 2317/51C07K 2317/92C07K 2317/21A61K 2039/505C07K 2317/55C07K 2317/515A61K 39/3955C07K 2317/73C07K 2317/52C07K 16/00C07K 16/18C07K 16/24C07K 2317/622C07K 2317/54
56
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
M-CSF-specific antibody RX1 is provided, along with pharmaceutical compositions containing antibody RX1, kits containing a pharmaceutical composition, and methods of preventing and treating bone loss in a subject afflicted with an osteolytic disease.
Claims
exact text as granted — not AI-modified1 . A non-murine antibody that competes with monoclonal antibody RX1 for binding to M-CSF by more than 75%, wherein said monoclonal antibody RX1 comprising the heavy chain and light chain amino acid sequences set forth in SEQ ID NOs: 2 and 4, respectively.
2 . The antibody of claim 1 that specifically binds to the same epitope of M-CSF as monoclonal antibody RX1, wherein said monoclonal antibody RX1 comprises the heavy chain and light chain amino acid sequences set forth in SEQ ID NOs: 2 and 4, respectively.
3 . The antibody of claim 2 that binds an epitope of M-CSF that comprises at least 4 contiguous residues of SEQ ID NO: 120 or 121.
4 . The antibody of claim 2 that binds an epitope of M-CSF that comprises SEQ ID NO: 120 or 121.
5 . (canceled)
6 . The antibody of any of claims 1 - 4 that is a chimeric antibody, a humanized antibody, a human engineered antibody, a human antibody, of a single chain antibody, a monoclonal antibody, an IgG antibody, Fab fragment, an F (ab′) 2 fragment, an Fv fragment, or a single chain Fv fragment.
7 - 8 . (canceled)
9 . The antibody of claim 1 that retains an affinity Kd (dissociation equilibrium constant) with respect to M-CSF of SEQ ID NO: 9 of at least 10-7 M or higher.
10 - 11 . (canceled)
12 . The antibody of claim 1 that comprises an amino acid sequence 90% identical to SEQ ID NO: 24.
13 . (canceled)
14 . The antibody of claim 1 that comprises at least 1 of SEQ ID NOs: 18, 21, 24, 29, 32, and 36.
15 .- 19 . (canceled)
20 . The antibody of claim 14 that further comprises one or more of SEQ ID NOs: 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 28, 29, 30, 32, 33, 34, 35, 37, and 38.
21 .- 23 . (canceled)
24 . The antibody of claim 14 in which at least one amino acid within a CDR is substituted by a corresponding residue of a corresponding CDR of another anti-MCSF antibody.
25 . The antibody of claim 14 comprising a variable light chain amino acid sequence which is at least 65% homologous to the amino acid sequence set forth in SEQ ID NO: 4.
26 . The antibody of claim 14 comprising a variable heavy chain amino acid sequence which is at least 65% homologous to the amino acid sequence set forth in SEQ ID NO: 2.
27 . The antibody of claim 6 comprising a constant region of a human antibody sequence and one or more heavy and light chain variable framework regions of a human antibody sequence.
28 . The antibody of claim 27 wherein the human antibody sequence is an individual human sequence, a human consensus sequence, an individual human germline sequence, or a human consensus germline sequence.
29 . The antibody of claim 27 that comprises a fragment of an IgG1 constant region.
30 . The antibody of claim 29 that comprises a mutation in the IgG1 constant region that reduces antibody-dependent cellular cytotoxicity or complement dependent cytotoxicity activity.
31 . The antibody of claim 27 that comprises a fragment of an IgG4 constant region.
32 . The antibody of claim 31 that comprises a mutation in the IgG4 constant region that reduces formation of half-antibodies.
33 . The antibody of claim 6 , comprising a heavy chain variable region that comprises the amino acid sequence selected from the group consisting of:
(a)
XVXLXEXGXXXXXXXXXLXLXCXVXDYSITSDYAWNWIXQXXXXXLX
WMGYISY;
SGSTSXNXXLXXXIXIXRXXXXXXFXLXLXXVXXXDXAXYYCASFDY
AHAMDYWGXGTXVXVXX,
(b)
DVXLXEXGPXXVXPXXXLXLXCXVTDYSITSDYAWNWIRQXPXXKLE
WMGYISYSGSTSYNPSLKXRIXIXRXTXXNXFXLXLXXVXXXDXATY
YCASFDYAHAMDYWGXGTXVXVXX;
(c)
XVQLQESGPGLVKPSQXLSLTCTVXDYSITSDYAWNWIRQFPGXXLE
WMGYISYSGSTSYNPSLKSRIXIXRDTSKNQFXLQLNSVTXXDTAXY
YCASFDYAHAMDYWGQGTXVTVSS;
(d)
DVQLQESGPGLVKPSQXLSLTCTVTDYSITSDYAWNWIRQFPGXKLE
WMGYISYSGSTSYNPSLKSRIXIXRDTSKNQFXLQLNSVTXXDTATY
YCASFDYAHAMDYWGQGTXVTVSS;
(e)
DVQLQESGPGLVKPSQTLSLTCTVTDYSITSDYAWNWIRQFPGKKLE
WMGYISYSGSTSYNPSLKSRITISRDTSKNQFSLQLNSVTAADTATY
YCASFDYAHAMDYWGQGTTVTV SS;
and
(f)
QVQLQESGPGLVKPSQTLSLTCTVSDYSITSDYAWNWIRQFPGKGLE
WMGYISYSGSTSYNPSLKSRITISRDTSKNQFSLQLNSVTAADTAVY
YCASFDYAHAMDYWGQGTTVTV SS;
wherein X is any amino acid.
34 - 38 . (canceled)
39 . The antibody of claim 6 , comprising a light chain variable region that comprises the amino acid sequence selected from the group consisting of:
(a)
XIXLXQXXXXXXVXXXXXVXFXCXAXQSIGTSIHWYXQXXXXXPXLL
IKYASEXXXXIXXXFXGXGXGXXFXLXIXXVXXXDXADYYCQQINSW
PTTFGXGTXLXXXXX;
(b)
XIXLXQXPXXLXVXPXXXVXFXCXASQSIGTSIHWYQQXTXXSPRLL
IKYASEXISXIPXRFXGXGXGXXFXLXIXXVXXXDXADYYCQQINSW
PTTFGXGTXLXXXXX;
(c)
XIXLTQSPXXLSVSPGERVXFSCRASQSIGTSIHWYQQXTXXXPRLL
IKYASEXXXGIPXRFSGSGSGTDFTLXIXXVESEDXADYYCQQINSW
PTTFGXGTKLEIKRX;
(d)
XIXLTQSPXXLSVSPGERVXFSCRASQSIGTSIHWYQQXTXXSPRLL
IKYASEXISGIPXRFSGSGSGTDFTLXIXXVESEDXADYYCQQINSW
PTTFGXGTKLEIKRX;
(e)
XIXLTQSPXXLSVSPGERVXFSCRASQSIGTSIHWYQQXTXXXXPRL
LIKYASESISGIPXRFSGSGSGTDFTLXIXXVESEDXADYYCQQINS
WPTTFGXGTKLEIKRX;
(f)
EIVLTQSPGTLSVSPGERVTFSCRASQSIGTSIHWYQQKTGQAPRLL
IKYASESISGIPDRFSGSGSGTDFTLTISRVESEDFADYYCQQINSW
PTTFGQGTKKEIKRT;
(g)
EIVLTQSPGTLSVSPGERVTFSCRASQSIGTSIHWYQQKTGQAPRLL
IKYASERATTGIPDRFSGSGSGTDFTLTISRVESEDFADYYCQQINS
WPTTFGQGTKLEIKRT;
and
(h)
EIVLTQSPGTLSVSPGERVTFSCRASQSIGTSIHWYQ
QKTGQSPRL
LIKYASERISGIPDRFSGSGSGTDFTLTISRVESEDFADYYCQQINS
WPTTFGQGTKLEIKRT;
wherein X is any amino acid.
40 - 46 . (canceled)
47 . The antibody of any of claims 33 or 39 wherein at least one X is the same as an amino acid at the same corresponding position in SEQ ID NOs: 2 or 4 using Kabat numbering.
48 . The antibody of any of claims 33 or 39 , wherein at least one X is a conservative substitution of an amino acid at the same corresponding position in SEQ ID NOs: 2 or 4 using Kabat numbering.
49 . (canceled)
50 . The antibody of any of claims 33 or 39 , wherein at least one X is an amino acid at the same corresponding position within a human antibody sequence, using Kabat numbering.
51 . The antibody of any of claims 33 or 39 , wherein at least one X is an amino acid at the same corresponding position within a human consensus antibody sequence, using Kabat numbering.
52 . The antibody of claim 50 wherein the human antibody sequence is a human consensus sequence, human germline sequence, human consensus germline sequence, or any one of the human antibody sequences in Kabat.
53 . The antibody of claim 6 comprising any one of the heavy chain sequences set forth in SEQ ID NOS: 41, 43, 114, 116, or 119.
54 . (canceled)
55 . The antibody of claim 6 comprising any one of the light chain sequences set forth in SEQ ID NOS: 45,47, 48, 51, 53 or 136.
56 . The antibody of claim 1 comprising the heavy chain sequence set forth in SEQ ID NO: 114 and the light chain sequence set forth in SEQ ID NO: 47.
57 . The antibody of claim 1 comprising the heavy chain sequence set forth in SEQ ID NO: 116 and the light chain sequence set forth in SEQ ID NO: 47.
58 . The antibody of claim 1 comprising the heavy chain sequence set forth in SEQ ID NO: 119 and the light chain sequence set forth in SEQ ID NO: 47.
59 . The antibody of any of claims 33 or 39 comprising a variable heavy chain amino acid sequence which is at least 65% identical to the variable heavy chain amino acid sequence set forth in SEQ ID NOs: 41 or 43.
60 . The antibody of claim 59 comprising a variable heavy chain amino acid sequence which is at least 80% identical to the variable heavy chain amino acid sequence set forth in SEQ ID NOs: 41 or 43.
61 . The antibody of any of claims 33 or 39 comprising a variable light chain amino acid sequence which is at least 65% identical to the variable light chain amino acid sequence set forth in SEQ ID NOs: 45, 47, 48, 51, or 53.
62 . The antibody of claim 61 comprising a variable light chain amino acid sequence which is at least 80% identical to the variable light chain amino acid sequence set forth in SEQ ID NOs: 45, 47, 48, 51, or 53.
63 . An antibody comprising a heavy chain as set forth in claim 59 and a light chain as set forth in of claims 61 .
64 . The antibody of any of claims 12 , 14 , 20 , 24 - 46 , 53 , 55 - 58 and 63 that has an affinity Kd of at least 10-7.
65 . The antibody of claim 64 that has an affinity Kd of at least 10-9.
66 .- 78 . (canceled)
79 . A pharmaceutical composition comprising an antibody of claim 1 , and a pharmaceutically suitable carrier, excipient or diluent.
80 . The pharmaceutical composition of claim 79 further comprising a second therapeutic agent.
81 . The pharmaceutical composition of claim 80 wherein the second therapeutic agent is a cancer chemotherapeutic agent.
82 . The pharmaceutical composition of claim 80 wherein the second therapeutic agent is a bisphosphonate.
83 . The pharmaceutical composition of claim 82 wherein the bisphonate is zeledronate, pamidronate, clodronate, etidronate, tilundronate, alendronate, or ibandronate.
84 . The pharmaceutical composition of claim 80 wherein the second therapeutic agent is another antibody.
85 . The antibody of claim 1 that binds to M-CSF for preventing a subject afflicted with a disease that causes or contributes to osteolysis, wherein said antibody effectively reduces the severity of bone loss associated with the disease.
86 . The antibody of claim 1 that binds to M-CSF for treating a subject afflicted with a disease that causes or contributes to osteolysis, wherein said antibody effectively reduces the severity of bone loss associated with the disease.
87 . The antibody according to claim 86 wherein said disease is selected from the group consisting of metabolic bone diseases associated with relatively increased osteoclast activity, including endocrinopathies (including hypercortisolism, hypogonadism, primary or secondary hyperparathyroidism, hyperthyroidism), hypercalcemia, deficiency states (including rickets/osteomalacia, scurvy, malnutrition), chronic diseases (including malabsorption syndromes, chronic renal failure (including renal osteodystrophy), chronic liver disease (including hepatic osteodystrophy)), drugs (including glucocorticoids (glucocorticoid-induced osteoporosis), heparin, alcohol), and hereditary diseases (including osteogenesis imperfecta, homocystinuria), cancer, osteoporosis, osteopetrosis, inflammation of bone associated with arthritis and rheumatoid arthritis, periodontal disease, fibrous dysplasia, and/or Paget's disease.
88 . The antibody according to claim 1 that binds to M-CSF for preventing or treating metastatic cancer to bone, wherein the metastatic cancer is breast, lung, renal, multiple myeloma, thyroid, prostate, adenocarcinoma, blood cell malignancies, including leukemia or lymphoma; head or neck cancers; gastrointestinal cancers, including esophageal cancer, stomach cancer, colon cancer, intestinal cancer, colorectal cancer, rectal cancer, pancreatic cancer, liver cancer, cancer of the bile duct or gall bladder; malignancies of the female genital tract, including ovarian carcinoma, uterine endometrial cancers, vaginal cancer, or cervical cancer; bladder cancer; brain cancer, including neuroblastoma; sarcoma, osteosarcoma; or skin cancer, including malignant melanoma or squamous cell cancer.
89 .- 135 . (canceled)
136 . A kit comprising a therapeutically effective amount of the antibody of claim 1 , packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to prevent or reduce bone loss.
137 . A kit comprising a therapeutically effective amount of the antibody of claim 1 , packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to a patient afflicted with a disease that causes or contributes to osteolysis.
138 . The kit of claim 137 wherein said disease is selected from the group consisting of metabolic bone diseases associated with relatively increased osteoclast activity, including endocrinopathies (including hypercortisolism, hypogonadism, primary or secondary hyperparathyroidism, hyperthyroidism), hypercalcemia, deficiency states (including rickets/osteomalacia, scurvy, malnutrition), chronic diseases (including malabsorption syndromes, chronic renal failure (including renal osteodystrophy), chronic liver disease (including hepatic osteodystrophy)), drugs (including glucocorticoids (glucocorticoid-induced osteoporosis), heparin, alcohol), and hereditary diseases (including osteogenesis imperfecta, homocystinuria), cancer, osteoporosis, osteopetrosis, inflammation of bone associated with arthritis and rheumatoid arthritis, periodontal disease, fibrous dysplasia, and/or Paget's disease.
139 . A kit comprising a therapeutically effective amount of the antibody of claim 1 , packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to prevent or treat metastatic cancer to bone.
140 . The kit of claim 139 wherein the metastatic cancer is breast, lung, renal, multiple myeloma, thyroid, prostate, adenocarcinoma, blood cell malignancies, including leukemia or lymphoma; head or neck cancers; gastrointestinal cancers, including esophageal cancer, stomach cancer, colon cancer, intestinal cancer, colorectal cancer, rectal cancer, pancreatic cancer, liver cancer, cancer of the bile duct or gall bladder; malignancies of the female genital tract, including ovarian carcinoma, uterine endometrial cancers, vaginal cancer, or cervical cancer; bladder cancer; brain cancer, including neuroblastoma; sarcoma, osteosarcoma; or skin cancer, including malignant melanoma or squamous cell cancer.
141 . A kit comprising a therapeutically effective amount of the antibody of claim 1 , packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat cancer.
142 . The kit of any of claims 136 - 141 further comprising a second therapeutic agent.
143 . The kit of claim 142 wherein the second therapeutic agent is a cancer chemotherapeutic agent.
144 . The kit of claim 142 wherein the second therapeutic agent is a non-M-CSF colony stimulating factor, or anti-RANKL antibody, or soluble RANKL receptor.
145 . The kit of claims 142 wherein the second therapeutic agent is a bisphosphonate.
146 . The kit of claim 145 wherein the bisphonate is zeledronate, pamidronate, clodronate, etidronate, tilundronate, alendronate, or ibandronate.
147 . The kit of claim 146 including instructions to treat a patient precluded from receiving bisphosphonate treatment.
148 . The kit of claim 147 comprising a dose of antibody effective to reduce the dosage of second therapeutic agent required to achieve a therapeutic effect.
149 . The kit of claim 147 comprising a synergistic dose of antibody.
150 . The kit of claim 147 comprising a dose of antibody effective to inhibit osteoclast proliferation and/or differentiation induced by tumor cells.
151 . The kit of claim 147 comprising a dose of antibody between about 2 pg/kg to 30 mg/kg body weight.
152 . The kit of claim 151 comprising a dose of antibody between about 0.1 mg/kg to 30 mg/kg body weight.
153 . The kit of claim 152 comprising a dose of antibody between about 0.1 mg/kg to 10 mg/kg body weight.
154 .- 161 . (canceled)Join the waitlist — get patent alerts
Track US2009324604A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.