US2008182787A1PendingUtilityA1

Agent and compositions comprising the same for inhibiting lipases and phospholipases in body fluids, cells and tissues

Assignee: RELIANCE LIFE SCIENCES PVT LTDPriority: Mar 30, 2004Filed: Oct 30, 2007Published: Jul 31, 2008
Est. expiryMar 30, 2024(expired)· nominal 20-yr term from priority
A61P 9/00A61P 9/10A61P 3/10A61P 29/00A61P 25/16A61P 3/04A61K 38/00C07K 14/415C12N 15/8247A61P 19/02
53
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The present invention deals with a protein and compositions comprising the same for inhibition of lipases and phospholipases in the body fluids, cells, and tissues for the prevention and treatment of metabolic syndrome, cardiovascular disorders, and inflammatory diseases. The protein is either isolated from plant species or synthesized or produced by recombinant DNA technology.

Claims

exact text as granted — not AI-modified
1 . A protein comprising 5-100 amino acid residues and having a molecular weight ranging from 0.5-10 kD, with or without glycosylation, the protein having an inhibitory or reducing effect on lipase and phospholipase enzyme activities wherein the protein has partial sequence ID as following SEQ. ID. NO. 1: CGQQLRNISPPQRCPSLRQAVQLAHQQQGQGPQQVRQMYR, and is produced using any suitable method of protein isolation, or synthesized or produced through recombinant DNA technology. 
     
     
         2 - 3 . (canceled) 
     
     
         4 . The protein of  claim 1 , wherein the protein is isolated from plant material. 
     
     
         5 . The protein of  claim 1 , wherein the protein is isolated from the  Moringa  species. 
     
     
         6 . A composition for inhibition of lipases and phospholipases in the body fluids, cells, and tissues comprising: a protein as claimed in  claim 1  in a therapeutically effective amount. 
     
     
         7 . The composition of  claim 6 , wherein the protein is produced using any suitable method of protein isolation, or synthesized or produced through recombinant DNA technology. 
     
     
         8 . The composition of  claim 6 , wherein the protein is isolated from plant material. 
     
     
         9 . The composition of  claim 6 , wherein the protein is isolated from the  Moringa  species. 
     
     
         10 . A composition for preventing or treating obesity, diabetes, atherosclerosis, or another metabolic syndrome, the compositions comprising a protein as claimed in  claim 1 . 
     
     
         11 . The composition of  claim 10 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         12 . The composition of  claim 9 , wherein the protein is isolated from plant material. 
     
     
         13 . The composition of  claim 9 , wherein the protein is isolated from the  Moringa  species. 
     
     
         14 . A composition for preventing or treating cardiovascular disorders comprising a protein as claimed in  claim 1 . 
     
     
         15 . The composition of  claim 13 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         16 . The composition of  claim 13 , wherein the protein is isolated from plant material. 
     
     
         17 . The composition of  claim 13 , wherein the protein is isolated from the  Moringa  species. 
     
     
         18 . A composition for preventing or treating arthritis, atherosclerosis, septic shock, and other inflammatory diseases caused by the activation and/or the action of phospholipases, the composition comprising a protein as claimed in  claim 1 . 
     
     
         19 . The composition of  claim 17 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         20 . The composition of  claim 17 , wherein the protein is isolated from plant material. 
     
     
         21 . The composition of  claim 17 , wherein the protein is isolated from the  Moringa  species. 
     
     
         22 . A composition for inhibiting or reducing accumulation of lipids in monocytic cells, vascular cells, hepatocytes, and adipose tissues, the composition comprising a protein as claimed in  claim 1 . 
     
     
         23 . The composition of  claim 21 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         24 . The composition of  claim 21 , wherein the protein is isolated from plant material. 
     
     
         25 . The composition of  claim 21 , wherein the protein is isolated from the  Moringa  species. 
     
     
         26 . A composition for preventing or treating cellular and tissue damage caused by microbial pathogens secreting lipases and phospholipases, the composition comprising a protein as claimed in  claim 1 . 
     
     
         27 . The composition of  claim 25 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         28 . The composition of  claim 25 , wherein the protein is isolated Previously Presented from plant material. 
     
     
         29 . The composition of  claim 25 , wherein the protein is isolated from the  Moringa  species. 
     
     
         30 . A composition for skin and hair care and cosmetic Previously Presented preparations comprising a protein as claimed in  claim 1 . 
     
     
         31 . The composition of  claim 29 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         32 . The composition of  claim 29 , wherein the protein is isolated from plant material. 
     
     
         33 . The composition of  claim 29 , wherein the protein is isolated from the  Moringa  species. 
     
     
         34 . A composition for use in veterinary medicine for the treatment and prophylaxis of diseases caused or aggravated by lipase and phospholipase activity in the body fluids, cells, and tissues, the composition comprising a protein as claimed in  claim 1 . 
     
     
         35 . The composition of  claim 33 , wherein the protein is produced using any suitable method of protein purification, or synthesized or produced through recombinant DNA technology. 
     
     
         36 . The composition of  claim 33 , wherein the protein is isolated from plant material. 
     
     
         37 . The composition of  claim 33 , wherein the protein is isolated from the  Moringa  species. 
     
     
         38 . A formulation comprising of protein as claimed in  claim 1  either alone or in combination with known pharmaceutically acceptable and inert adjuvant, diluent or carrier. 
     
     
         39 . The formulation comprising of protein as claimed in  claim 1  either alone or in combination with at least one additional active ingredient. 
     
     
         40 . The formulation comprising of protein as claimed in  claim 1  may be administered once or a few times a day in an amount of about 10 to 2000 mg/day in terms of dry weight. 
     
     
         41 . The formulation as claimed in  claim 37 , wherein the formulation is adapted to be administered via a route selected from the group consisting of: oral, intra-venous, intra-nasal, and transdermal. 
     
     
         42 . The formulation as claimed in  claim 37 , wherein the suitable forms for oral administration include tablets, capsules, granules, fine granules, spherules, syrups, and drinks, more preferably it is in the form of spherules. 
     
     
         43 . The formulation as claimed in  claim 37 , wherein the formulation can be administered by following conventional dosage regimen. 
     
     
         44 . The formulation as claimed in  claim 37 , wherein the formulation can be administered by any modified release, controlled release or timed release formulations. 
     
     
         45 . A method for inhibition of lipases and phospholipases in the body fluids, cells, and tissues comprising the step of administering to a patient in need thereof a composition comprising an effective amount of a protein as claimed in  claim 4 . 
     
     
         46 . A method for inhibiting or reducing accumulation of lipids in monocytic cells, vascular cells, hepatocytes, and adipose tissues, the method of comprising the step of administering to a patient in need thereof a composition comprising an effective amount of a protein as claimed in  claim 4 . 
     
     
         47 . A method for preventing or treating obesity, diabetes, atherosclerosis, or another metabolic syndrome, the method comprising the step of administering to a patient in need thereof a composition comprising an effective amount of a protein as claimed in  claim 4 . 
     
     
         48 . A method for preventing or treating arthritis, septic shock, and other inflammatory diseases caused by the activation and/or the action of phospholipases, the method comprising the step of administering to a patient in need thereof a composition comprising an effective amount of a protein as claimed in  claim 4 . 
     
     
         49 . (canceled) 
     
     
         50 . A method for preventing and treating cellular and tissue damage comprising administering about 10 to 2000 mg/day dry weight amount of a protein at least once a day to a patient for the treatment of cellular damage caused by microbial pathogens secreting lipases and tissue damage caused by microbial pathogens secreting lipases and phospholipases, wherein the protein is SEQ. ID. NO. 1: 
       
         
           
                 
                 
                 
               
                     
                   GQQLRNISPPQRCPSLRQAVQLAHQQQGQGPQQVRQMYR 
                     
                 
             
                
               
            
           
         
         and including from about 40 to 100 amino acid residues. 
       
     
     
         51 . A method as claimed in  claim 50 , for inhibition or reducing an accumulation of lipids in the body comprising administering an effective amount of the protein to a patient in need of a treatment for lipid reduction. 
     
     
         52 . The method as claimed in  claim 50 , for prevention or treatment of increased lipase activity in the body comprising administering an effective amount of the protein to a patient for treating diseases or disorders with increased lipase activity. 
     
     
         53 . The method as claimed in  claim 50 , for the prevention or treatment of inflammation in the body comprising administering an effective amount of the protein to a patient for treating inflammatory diseases caused by the activation and/or the action of phospholipases. 
     
     
         54 . A method of treating disorders selected from the group consisting of obesity, ischemic heart diseases, arteriosclerosis, cerebrovascular dementia, diabetes, angiopathic Parkinson's diseases, and inflammatory diseases requiring the use of a protein for the inhibition of lipases, comprising:
 providing a person in need thereof with an amount of about 10 to 2000 mg/day, dry weight at least once a day of a protein for the inhibition of lipases having a partial sequence ID as follows:   
       
         
           
                 
                 
                 
               
                     
                   SEQ. ID. NO. 1: 
                     
                 
                     
                   GQQLRNISPPQRCPSLRQAVQLAHQQQGQGPQQVRQMYR 
                 
             
                
                
               
            
           
         
       
       and the protein consists essentially of 40 to 100 amino acid residues; and
 wherein the protein is produced by using any suitable method of protein isolation from plant material or method of synthesis through recombinant DNA technology.

Join the waitlist — get patent alerts

Track US2008182787A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.