US2007196374A1PendingUtilityA1
Anti-vegf antibodies
Est. expiryApr 7, 2017(expired)· nominal 20-yr term from priority
C07K 2317/55A61K 2039/505C07K 2317/567C07K 2317/24A61P 35/00C07K 2317/73C07K 16/22C07K 2317/565C07K 2317/92
63
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Humanized and variant anti-VEGF antibodies and various uses therefor are disclosed. The anti-VEGF antibodies have strong binding affinities for VEGF; inhibit VEGF-induced proliferation of endothelial cells in vitro; and inhibit tumor growth in vivo.
Claims
exact text as granted — not AI-modified1 . A humanized anti-vascular endothelial growth factor (VEGF) antibody which binds human VEGF with a K d value of no more than about 1×10 −8 M.
2 . A humanized anti-vascular endothelial growth factor (VEGF) antibody which binds human VEGF with a K d value of no more than about 5×10 −9 M.
3 . A humanized anti-vascular endothelial growth factor (VEGF) antibody which has an ED50 value of no more than about 5 nM for inhibiting VEGF-induced proliferation of endothelial cells in vitro.
4 . A humanized anti-vascular endothelial growth factor (VEGF) antibody which inhibits VEGF-induced angiogenesis in vivo.
5 . The humanized anti-VEGF antibody of claim 4 wherein 5 mg/kg of the antibody inhibits tumor growth by at least about 50% in tumor weight in vivo in nude mice transformed with human A673 rhabdomyosarcoma cells.
6 . The humanized anti-VEGF antibody of claim 1 having a heavy chain variable domain comprising the following complementarity determining region (CDR) amino acid sequences:
7 . The humanized anti-VEGF antibody of claim 6 comprising the amino acid sequence of SEQ ID NO:7.
8 . The humanized anti-VEGF antibody of claim 6 having a heavy chain variable domain comprising the following hypervariable region amino acid sequences: CDRH1 (GYTFTNYGMN; SEQ ID NO:1), CDRH2 (WINTYTGEPTYMDFKR; SEQ ID NO:2) and CDRH3 (YPHYYGSSHWYFDV; SEQ ID NO:3).
9 . The humanized anti-VEGF antibody of claim 1 having a light chain variable domaincomprising the following hypervariable region amino acid sequences: CDRL1 (SASQDISNYLN;SEQ ID NO:4), CDRL2 (FTSSLHS; SEQ ID NO:5) and CDRL3 (QQYSTVPWT; SEQ ID NO:6).
10 . The humanized anti-VEGF antibody of claim 9 comprising the amino acid sequence of SEQ ID NO:8.
11 . The humanized anti-VEGF antibody of claim 1 having a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:7 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:8.
12 . An anti-VEGF antibody light chain variable domain comprising the amino acid sequence: DIQX 1 TQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSG SGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKR (SEQ ID NO:126), wherein X 1 is M or L.
13 . An anti-VEGF antibody heavy chain variable domain comprising the amino acid sequence: EVQLVESGGGLVQPGGSLRLSCAASGYX 1 FTX 2 YGMNWVRQAPGKGLEWVGWINTYTGEPTY AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPX 3 YYGX4SHWYFDVWGQGTLVTV SS (SEQ ID NO:127), wherein X 1 is T or D; X 2 is N or H; X 3 is Y or H and X 4 is S or T.
14 . A variant of a parent anti-vascular endothelial growth factor (VEGF) antibody, wherein said variant binds human VEGF and comprises an amino acid substitution in a complementarity determining region (CDR) of a heavy chain variable domain of said parent antibody.
15 . The variant of claim 14 wherein said parent antibody is a human or humanized antibody.
16 . The variant of claim 14 which binds human VEGF with a K d value of no more than about 1×10 −8 M.
17 . The variant of claim 14 which binds human VEGF with a K d value of no more than about 5×10 9 M.
18 . The variant of claim 14 wherein the substitution is in CDRH1 of the heavy chain variable domain.
19 . The variant of claim 14 wherein the substitution is in CDRH3 of the heavy chain variable domain.
20 . The variant of claim 14 which has amino acid substitutions in both CDRH1 and CDRH3.
21 . The variant of claim 14 which binds human VEGF with a K d value less than that of said parent antibody.
22 . The variant of claim 14 which has an ED50 value for inhibiting VEGF-induced proliferation of endothelial cells in vitro which is at least about 10 fold lower than that of said parent antibody.
23 . The variant of claim 18 wherein the CDRH1 comprises the amino acid sequence:
GYDFTHYGMN
(SEQ ID NO:128)
24 . The variant of claim 19 wherein the CDRH3 comprises the amino acid sequence:
YPYYYGTSHWYFDV. (SEQ ID NO:129)
25 . The variant of claim 14 wherein the heavy chain variable domain comprises the amino acid sequence of SEQ ID NO:118.
26 . The variant of claim 25 further comprising the light chain variable domain amino acid sequence of SEQ ID NO:126.
27 . The variant of claim 26 comprising the light chain variable domain amino acid sequence of SEQ ID NO:117.
28 . The humanized anti-VEGF antibody of claim 1 which is a full length antibody.
29 . The humanized anti-VEGF antibody of claim 28 which is a human IgG.
30 . The humanized anti-VEGF antibody of claim 1 which is an antibody fragment.
31 . The antibody fragment of claim 30 which is a Fab.
32 . A composition comprising the humanized anti-VEGF antibody of claim 1 and a pharmaceutically acceptable carrier.
33 . A composition comprising the variant anti-VEGF antibody of claim 14 and a pharmaceutically acceptable carrier.Join the waitlist — get patent alerts
Track US2007196374A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.