Synthetic vaccine for tick control

Abstract

This invention is related to the field of immunology of protein biotechnology and particularly to the construction of synthetic immunogens which result, where inoculated, in the production by cattle of an immune response capable of lesion to the ticks feeding on the inoculated bovines, reducing their number, their weight and their reproductive capacity to such an extent that the constructed immunogen can be used as an effective vaccine for tick control on bovines. The technical object of the invention consists of the design and construction of two synthetic immunogens constituted of a continuous and defined sequence with forty-three (43) amino acids, found in different positions in the sequence of protein Bm86, their polymerization with cysteine in the N-terminal and in the C-terminal, the medicamentous composition based on said peptide(s) and the synthetic vaccine obtained thereby.

What is claimed is:  
     
         1 . A synthetic vaccine against ticks characterized by the construction of the synthetic immunogen SBm4912 (Synthetic  Boophilus microplus  4912), constituted of a continuous and defined sequence with forty-three (43) amino acids found in different positions in the sequence of protein Bm86, its polymerization with cysteine in the N-terminal and in the C-terminal, CLSKHVLRKLQACEHSSICSDFGNEFCRNACDCGEWGAMNMTTRC, which, when inoculated on bovines is characterized by producing immunity against ticks, reducing their number and their reproductive capacity.  
     
     
         2 . A synthetic vaccine against ticks characterized by the construction of the synthetic immunogen SBm7462 (Synthetic  Boophilus microplus  7462), constituted of a continuous and defined sequence with forty-three (43) amino acids found in different positions in the sequence of protein Bm86, its polymerization with cysteine in the N-terminal and in the C-terminal, CLSKHVLRKLQACEHCDCGEWGAMNMTTRSSICSDFGNEFCRNAC, which, when inoculated on bovines is characterized by producing immunity against ticks, reducing their number and their reproductive capacity.  
     
     
         3 . The medicamentous composition of the synthetic vaccine against ticks, formed by the synthetic immunogen SBm4912 or SBm7462 plus an adequate adjuvant, in any dosage of the mixture characterized by the use of these synthetic immunogens which are thus characterized by producing immunity against ticks, reducing their numbers and their reproductive capacity.