US2003180759A1PendingUtilityA1

HIV-1 group O antigens and uses thereof

Assignee: INNOGENETICS NVPriority: Jul 18, 1997Filed: Dec 16, 2002Published: Sep 25, 2003
Est. expiryJul 18, 2017(expired)· nominal 20-yr term from priority
A61K 39/00C07K 14/005A61K 2039/51C12N 7/00C12N 2740/15022C12N 2740/16021C12N 2740/16122Y10S435/974Y10S435/975Y10S530/826
50
PatentIndex Score
0
Cited by
0
References
0
Claims

Abstract

The current invention relates to new HIV-1 group O antigens, nucleic acids encoding them, and the use of said antigens and/or nucleic acids as reagents in the diagnosis and prophylaxis of AIDS. It also relates to new HIV-1 group O strains comprising these antigens.

Claims

exact text as granted — not AI-modified
1 . Antigen derived from the gp160 env precursor protein of a new HIV-1 group O strain comprising at least one amino acid sequence chosen from the following group of sequences:  
       
         
           
                 
                 
                 
                 
               
                     
                     
                 
                     
                   VQQMKI, 
                   (SEQ ID NO 53) 
                     
                 
                     
                     
                 
                     
                   KIGPMSWYSMG, 
                   (SEQ ID NO 54) 
                 
                     
                     
                 
                     
                   MGLEKN, 
                   (SEQ ID NO 55) 
                 
                     
                     
                 
                     
                   IQQMKI, 
                   (SEQ ID NO 56) 
                 
                     
                     
                 
                     
                   KIGPLAWYSMG, 
                   (SEQ ID NO 57) 
                 
                     
                     
                 
                     
                   MGLERN, 
                   (SEQ ID NO 58) 
                 
                     
                     
                 
                     
                   QSVQEIKI, 
                   (SEQ ID NO 59) 
                 
                     
                     
                 
                     
                   KIGPMAWYSIG, 
                   (SEQ ID NO 60) 
                 
                     
                     
                 
                     
                   IGIGTT, 
                   (SEQ ID NO 61) 
                 
                     
                     
                 
                     
                   VQEIQT, 
                   (SEQ ID NO 62) 
                 
                     
                     
                 
                     
                   QTGPMAWYSIH, 
                   (SEQ ID NO 63) 
                 
                     
                     
                 
                     
                   IHLRTP, 
                   (SEQ ID NO 64) 
                 
                     
                     
                 
                     
                   IQEIKI, 
                   (SEQ ID NO 65) 
                 
                     
                     
                 
                     
                   KIGPMSWYSMG, 
                   (SEQ ID NO 66) 
                 
                     
                     
                 
                     
                   MGIGQE, 
                   (SEQ ID NO 67) 
                 
                     
                     
                 
                     
                   SVQELRI, 
                   (SEQ ID NO 68) 
                 
                     
                     
                 
                     
                   RIGPMAWYSMT, 
                   (SEQ ID NO 69) 
                 
                     
                     
                 
                     
                   MTLERD, 
                   (SEQ ID NO 70) 
                 
                     
                     
                 
                     
                   SVQEIPI, 
                   (SEQ ID NO 136) 
                 
                     
                     
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       and/or at least one amino acid sequence chosen from the following group of sequences:  
       
         
           
                 
                 
                 
                 
               
                     
                     
                 
                     
                   RNQQLLNLWGCKGRLIC, 
                   (SEQ ID NO 71) 
                     
                 
                     
                     
                 
                     
                   CKGRLICYTSVQWNM, 
                   (SEQ ID NO 72) 
                 
                     
                     
                 
                     
                   LWGCKGRIVC, 
                   (SEQ ID NO 73) 
                 
                     
                     
                 
                     
                   SLWGCKGKLIC, 
                   (SEQ ID NO 74) 
                 
                     
                     
                 
                     
                   CKGKSIC, 
                   (SEQ ID NO 75) 
                 
                     
                     
                 
                     
                   CKGKIVC, 
                   (SEQ ID NO 76) 
                 
                     
                     
                 
                     
                   CRGRQVC, 
                   (SEQ ID NO 77) 
                 
                     
                     
                 
                     
                   CKGRLICYTSVH, 
                   (SEQ ID NO 79) 
                 
                     
                     
                 
                     
                   CKGNLIC, 
                   (SEQ ID NO 80) 
                 
                     
                     
                 
                     
                   CKGKMIC, 
                   (SEQ ID NO 81) 
                 
                     
                     
                 
                     
                   CKGRVVC, 
                   (SEQ ID NO 82) 
                 
                     
                     
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       or a fragment of said antigen, said fragment consisting of at least 8, preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 50 up to the maximum number of contiguous amino acids of the amino acid sequence of said antigen, with said fragment being characterized by the fact that it specifically reacts with antibodies raised against said antigen.  
     
     
         2 . Antigen according to  claim 1 , characterized by an amino acid sequence comprising at least one of the following amino acid sequences:  
       
         
           
                 
                 
                 
               
                     
                 
                   (SEQ ID NO 83) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERPGNNSIQQMKIGPLAWYSMGLERNKSSISRLAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 84) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERPGNNSIQQMKIGPMAWYSMGLERNKSSISRLAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 85) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERPGNQSVQEIKIGPMAWYSIGIGTTPANWSRIAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 86) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERPGNQSVQEIKIGPMAWYSIGIGTTPTYNWSRIAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 87) 
                     
                     
                 
                 
                 
                 
               
                     
                   CVRPWNQTVQEIQTGPMAWYSIHLRTPLANLSRIAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 88) 
                     
                     
                 
                 
                 
                 
               
                     
                   CQRPGNLTIQEIKIGPMSWYSMGIGQEDHSKSRNAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 89) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERPYYQSVQELRIGPMAWYSMTLERDRAGSDIRAAYC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 90) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERPGNHTVQQMKIGPMSWYSMGLEKNNTSSRRAFC, 
                     
                 
                     
                     
                 
                 
                 
                 
               
                   (SEQ ID NO 135) 
                     
                     
                 
                 
                 
                 
               
                     
                   CERTWNQSVQEIPIGPMAWYSMSVELDLNTTGSRSADC, 
                     
                 
                     
                     
                 
             
                
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
             
                
               
            
             
                
                
               
            
           
         
       
       and/or at least one amino acid sequence chosen from the following group of sequences:  
       
         
           
                 
                 
                 
                 
               
                     
                     
                 
                     
                   DQQLLNLWGCKGRIVCYTSVKWN, 
                   (SEQ ID NO 91) 
                     
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGRLVCYTSVKWNK, 
                   (SEQ ID NO 92) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGRLVCYTSVKWNN, 
                   (SEQ ID NO 138) 
                 
                     
                     
                 
                     
                   NQQRLNLWGCKGKMICYTSVPWN, 
                   (SEQ ID NO 93) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGKSICYTSVKWN, 
                   (SEQ ID NO 94) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGRLICYTSVQWN, 
                   (SEQ ID NO 95) 
                 
                     
                     
                 
                     
                   NQQRLNLWGCKGKMICYTSVKWN, 
                   (SEQ ID NO 96) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGNLICYTSVKWN, 
                   (SEQ ID NO 97) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCRGRQVCYTSVIWN, 
                   (SEQ ID NO 98) 
                 
                     
                     
                 
                     
                   SQQLLNLWGCKGRLICYTSVHWN, 
                   (SEQ ID NO 99) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGRIVCYTSVKWN, 
                   (SEQ ID NO 100) 
                 
                     
                     
                 
                     
                   NQQLLNSWGCKGKIVCYTAVKWN, 
                   (SEQ ID NO 101) 
                 
                     
                     
                 
                     
                   NQQLLSLWGCKGKLICYTSVKWN, 
                   (SEQ ID NO 102) 
                 
                     
                     
                 
                     
                   NQQLLNLWGCKGRLVCYTSVQWN, 
                   (SEQ ID NO 137) 
                 
                     
                     
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
       or a fragment of said antigen, said fragment consisting of at least 8, preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 50 up to the maximum number of contiguous amino acids of the amino acid sequence of said antigen, with said fragment being characterized by the fact that it specifically reacts with antibodies raised against said antigen.  
     
     
         3 . Antigen according to any of  claims 1  to  2 , characterized by an amino acid sequence comprising at least one of the amino acid sequences represented by SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10, SEQ ID NO 12, SEQ ID NO 14, SEQ ID NO 16, SEQ ID NO 18, SEQ ID NO 20, SEQ ID NO 22, SEQ ID NO 24, SEQ ID NO 26, SEQ ID NO 28, SEQ ID NO 30, SEQ ID NO 32, SEQ ID NO 34, SEQ ID NO 36, SEQ ID NO 38, SEQ ID NO 40 as shown in the alignment on FIG. 1, and/or at least one of the amino acid sequences represented by SEQ ID NO 42, SEQ ID NO 44, SEQ ID NO 46, SEQ ID NO 48, SEQ ID NO 50, or SEQ ID NO 52 as shown in the alignment on FIG. 2, and/or the amino acid sequence represented by SEQ ID NO 134,  
       or a fragment of said antigen, said fragment consisting of at least 8, preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 50 up to the maximum number of contiguous amino acids of any of the sequences represented by SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10, SEQ ID NO 12, SEQ ID NO 14, SEQ ID NO 16, SEQ ID NO 18, SEQ ID NO 20, SEQ ID NO 22, SEQ ID NO 24, SEQ ID NO 26, SEQ ID NO 28, SEQ ID NO 30, SEQ ID NO 32, SEQ ID NO 34, SEQ ID NO 36, SEQ ID NO 38, SEQ ID NO 40, SEQ ID NO 42, SEQ ID NO 44, SEQ ID NO 46, SEQ ID NO 48, SEQ ID NO 50, SEQ ID NO 52, or SEQ ID NO 134 with said antigen fragment being characterized by the fact that it specifically reacts with antibodies raised against the antigen from which it is derived.  
     
     
         4 . A polynucleic acid encoding an antigen according to any of  claims 1  to  3 , and more particularly a polynucleic acid comprising a nucleotide sequence chosen from the group of 
 (I) a nucleotide sequence represented by SEQ ID NO 1, SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9, SEQ ID NO 11, SEQ ID NO 13, SEQ ID NO 15, SEQ ID NO 17, SEQ ID NO 19, SEQ ID NO 21, SEQ ID NO 23, SEQ ID NO 25, SEQ ID NO 27, SEQ ID NO 29, SEQ ID NO 31, SEQ ID NO 33, SEQ ID NO 35, SEQ ID NO 37, SEQ ID NO 39, SEQ ID NO 41, SEQ ID NO 43, SEQ ID NO 45, SEQ ID NO 47, SEQ ID NO 49, SEQ ID NO 51, SEQ ID NO 106 or  
 (ii) a nucleotide sequence complementary to a sequence according to (I), or  
 (iii) a nucleotide sequence showing at least 95%, preferably 96%, 97%, 98% and most preferably 99% homology to the fill length of a sequence according to (I), or  
 (iv) a nucleotide sequence according to (I) whereby T is replaced by U, or  
 (v) a nucleotide sequence according to (I) whereby at least one nucleotide is substituted by a nucleotide analogue.  
 
     
     
         5 . A nucleic acid fragment consisting of a sequence of at least 15, preferably 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 up to 50 contiguous nucleotides of the sequence of a polynucleic acid according to  claim 4 , with said nucleic acid fragment being characterized by the fact that it selectively hybridizes to said polynucleic acid and/or selectively amplifies said polynucleic acid.  
     
     
         6 . A virus strain belonging to HIV-1 group O, comprising in its genome a nucleic acid according to  claim 4 , and more particularly comprising in its genome the RNA equivalent of 
 one of the DNA sequences represented by SEQ ID NO 1, SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9, SEQ ID NO 11, SEQ ID NO 13, SEQ ID NO 15, SEQ ID NO 17, SEQ ID NO 19, SEQ ID NO 21, SEQ ID NO 23, SEQ ID NO 25, SEQ ID NO 27, SEQ ID NO 29, SEQ ID NO 31, SEQ ID NO 33, SEQ ID NO 35, SEQ ID NO 37, SEQ ID NO  39 , SEQ ID NO 106 and/or    one of the DNA sequences represented by SEQ ID NO 41, SEQ ID NO 43, SEQ ID NO  45 , SEQ ID NO 47, SEQ ID NO 49, SEQ ID NO 51, and/or    a variant sequence of the above-mentioned DNA sequences, said variant sequence showing at least 95% homology with the entire length of one of the above-mentioned sequences.    
     
     
         7 . A virus strain according to  claim 6 , deposited at the ECACC on Jun. 13, 1997 under accession number V97061301, V97061302 or V97061303, or deposited at the ECACC on Jul. 13, 1998, under provisional accession number V98071301 or V98071302.  
     
     
         8 . A polynucleic acid isolated from an HIV-1 group O strain according to any of  claims 6  to  7 .  
     
     
         9 . An antigen isolated from an HIV-1 group O strain according to any of  claims 6  to  7 .  
     
     
         10 . An antibody, preferably a monoclonal antibody, raised against an antigen or antigen fragment according to any of  claims 1  to  3 , or  claim 9 , with said antibody recognizing specifically the antigen or the antigen fragment to which it has been raised.  
     
     
         11 . A method for detecting the presence of an HIV-1 infection, said method comprising 
 the detection of antibodies against HIV-1, including HIV-1 group O, using an antigen or antigen fragment according to any of  claims 1  to  3 , or  claim 9 , and/or    the detection of viral antigen originating from HIV-1, including HIV-1 group O, using an antibody according to  claim 10 , and/or    the detection of viral nucleic acid originating from HIV-1, including HIV-1 group O, using a nucleic acid or nucleic acid fragment according to claims  4  or  5 , or  claim 8 , in a biological sample.    
     
     
         12 . A kit for the detection of the presence of an HIV-1 infection, comprising at least one of the antigens or antigen fragments according to any of  claims 1  to  3 , or  claim 9 , and/or at least one of the nucleic acids or nucleic acid fragments according to  claim 4  or  5 , or  claim 8  and/or an antibody according to  claim 10 .  
     
     
         13 . A vaccine composition which provides protective immunity against an HIV-1 infection, including an HIV-1 type O infection, comprising as an active principle at least one antigen or antigen fragment according to  claims 1  to  3 , or  9 , or at least one nucleic acid according to  claims 4  to  5 , or  8  or a virus like particle (VLP) comprising at least one antigen or antigen fragment according to  claims 1  to  3 , or  9 , or an attenuated form of at least one of the HIV-1 type O strains according to  claims 6  to  7 , said active principle being combined with a pharmaceutically acceptable carrier.

Join the waitlist — get patent alerts

Track US2003180759A1 — get alerts on status changes and closely related new filings.

We store only your email — no account needed. See our privacy policy.