US2002032315A1PendingUtilityA1
Anti-vegf antibodies
Priority: Aug 6, 1997Filed: Apr 6, 1998Published: Mar 14, 2002
Est. expiryAug 6, 2017(expired)· nominal 20-yr term from priority
C07K 2317/565A61P 35/00C07K 2317/73A61K 2039/505C07K 2317/92C07K 2317/567C07K 2317/24C07K 2317/55C07K 16/22
34
PatentIndex Score
0
Cited by
0
References
0
Claims
Abstract
Humanized and variant anti-VEGF antibodies and various uses therefor are disclosed. The anti-VEGF antibodies have strong binding affinities for VEGF; inhibit VEGF-induced proliferation of endothelial cells in vitro; and inhibit tumor growth in vivo.
Claims
exact text as granted — not AI-modifiedWhat is claimed is:
1 . A humanized anti-VEGF antibody which binds human VEGF with a K d value of no more than about 1×10 −8 M.
2 . A humanized anti-VEGF antibody which binds human VEGF with a K d value of no more than about 5×10 −9 M.
3 . A humanized anti-VEGF antibody which has an ED50 value of no more than about 5 nM for inhibiting VEGF-induced proliferation of endothelial cells in vitro.
4 . A humanized anti-VEGF antibody which inhibits VEGF-induced angiogenesis in vivo.
5 . The humanized anti-VEGF antibody of claim 4 wherein 5 mg/kg of the antibody inhibits at least about 50% of tumor growth in an A673 in vivo tumor model.
6 . The humanized anti-VEGF antibody of claim 1 having a heavy chain variable domain comprising the following hypervariable region amino acid sequences: CDRH1 (GYX 1 FTX 2 YGMN, wherein X 1 is T or D and X 2 is N or H; SEQ ID NO:128), CDRH2 (WINTYTGEPTYAADFKR; SEQ ID NO:2) and CDRH3 (YPX 1 YYGX 2 SHWYFDV, wherein X 1 is Y or H and X 2 is S or T; SEQ ID NO:129).
7 . The humanized anti-VEGF antibody of claim 6 comprising the amino acid sequence of SEQ ID NO:7.
8 . The humanized anti-VEGF antibody of claim 6 having a heavy chain variable domain comprising the following hypervariable region amino acid sequences: CDRH1 (GYTFTNYGMN; SEQ ID NO:1), CDRH2 (WINTYTGEPTYAADFKR; SEQ ID NO:2) and CDRH3 (YPHYYGSSHWYFDV; SEQ ID NO:3).
9 . The humanized anti-VEGF antibody of claim 1 having a light chain variable domain comprising the following hypervariable region amino acid sequences: CDRL1 (SASQDISNYLN; SEQ ID NO:4), CDRL2 (FTSSLHS; SEQ ID NO:5) and CDRL3 (QQYSTVPWT; SEQ ID NO:6).
10 . The humanized anti-VEGF antibody of claim 9 comprising the amino acid sequence of SEQ ID NO:8.
11 . The humanized anti-VEGF antibody of claim 1 having a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:7 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO:8.
12 . An anti-VEGF antibody light chain variable domain comprising the amino acid sequence: DIQX 1 TQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFS GSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIKR (SEQ ID NO:124), wherein X 1 is M or L.
13 . An anti-VEGF antibody heavy chain variable domain comprising the amino acid sequence: EVQLVESGGGLVQPGGSLRLSCAASGYX 1 FTX 2 YGMNWVRQAPGKGLEWVGWINTYTGEPT YAADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPX 3 YYGX 4 SHWYFDVWGQGTLV TVSS (SEQ ID NO:125), wherein X 1 is T or D; X 2 is N or H; X 3 is Y or H and X 4 is S or T.
14 . A variant of a parent anti-VEGF antibody, wherein said variant binds human VEGF and comprises an amino acid substitution in a hypervariable region of a heavy chain variable domain of said parent antibody.
15 . The variant of claim 14 wherein said parent antibody is a human or humanized antibody.
16 . The variant of claim 14 which binds human VEGF with a K d value of no more than about 1×10 −8 M.
17 . The variant of claim 14 which binds human VEGF with a K d value of no more than about 5×10 −9 M.
18 . The variant of claim 14 wherein the substitution is in CDRH1 of the heavy chain variable domain.
19 . The variant of claim 14 wherein the substitution is in CDRH3 of the heavy chain variable domain.
20 . The variant of claim 14 which has amino acid substitutions in both CDRH1 and CDRH3.
21 . The variant of claim 14 which binds human VEGF with a K d value less than that of said parent antibody.
22 . The variant of claim 14 which has an ED50 value for inhibiting VEGF-induced proliferation of endothelial cells in vitro which is at least about 10 fold lower than that of said parent antibody.
23 . The variant of claim 18 wherein the CDRH1 comprises the amino acid sequence: GYDFTHYGMN (SEQ ID NO:126)
24 . The variant of claim 19 wherein the CDRH3 comprises the amino acid sequence: YPYYYGTSHWYFDV (SEQ ID NO:127).
25 . The variant of claim 14 wherein the heavy chain variable domain comprises the amino acid sequence of SEQ ID NO:116.
26 . The variant of claim 25 further comprising the light chain variable domain amino acid sequence of SEQ ID NO:124.
27 . The variant of claim 26 comprising the light chain variable domain amino acid sequence of SEQ ID NO:115.
28 . The humanized anti-VEGF antibody of claim 1 which is a full length antibody.
29 . The humanized anti-VEGF antibody of claim 28 which is a human IgG.
30 . The humanized anti-VEGF antibody of claim 1 which is an antibody fragment.
31 . The antibody fragment of claim 30 which is a Fab.
32 . A composition comprising the humanized anti-VEGF antibody of claim 1 and a pharmaceutically acceptable carrier.
33 . A composition comprising the variant anti-VEGF antibody of claim 14 and a pharmaceutically acceptable carrier.
34 . Isolated nucleic acid encoding the antibody of claim 1 .
35 . A vector comprising the nucleic acid of claim 34 .
36 . A host cell comprising the vector of claim 35 .
37 . A process of producing a humanized anti-VEGF antibody comprising culturing the host cell of claim 36 so that the nucleic acid is expressed.
38 . The process of claim 37 further comprising recovering the humanized anti-VEGF antibody from the host cell culture.
39 . A method for inhibiting VEGF-induced angiogenesis in a mammal comprising administering a therapeutically effective amount of the humanized anti-VEGF antibody of claim 1 to the mammal.
40 . The method of claim 39 wherein the mammal is a human.
41 . The method of claim 39 wherein the mammal has a tumor.
42 . The method of claim 39 wherein the mammal has a retinal disorder.Join the waitlist — get patent alerts
Track US2002032315A1 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.