Antigen specific immunotherapy for COVID-19 fusion proteins and methods of use
Abstract
The present disclosure provides recombinantly manufactured fusion proteins comprising a SARS-CoV-2 Receptor Binding Domain (SARS-CoV-2-RBD) fragment or an analog thereof linked to a human Fc fragment for use in relation to the 2019 Novel Coronavirus (COVID-19). Embodiments include the administration of the fusion proteins to patients that have recovered from COVID-19 as a booster vaccination, to antibody naïve patients to produce antibodies to the SARS-CoV-2 virus to enable the patients to become convalescent plasma donors, to patients who have been infected by the SARS-CoV-2 virus and have contracted COVID-19 in order to limit the scope of the infection and ameliorate the disease, and as a prophylactic COVID-19 vaccine. Exemplary Fc fusion proteins and pharmaceutical formulations of exemplary Fc fusion proteins are provided, in addition to methods of use and preparation.
Claims
exact text as granted — not AI-modifiedWe claim:
1. A fusion protein comprising a viral receptor binding domain and an Fc fragment, wherein the viral receptor binding domain and the Fc fragment are connected by a peptide linker, wherein the fusion protein comprises the following sequence:
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFST FKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV IAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYF PLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGL TGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSGGGSGGGSDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 19).
2. The fusion protein of claim 1 , wherein the fusion protein is a homodimer.
3. The fusion protein of claim 1 , wherein the Fc fragment is glycosylated.
4. An immunogenic composition comprising a fusion protein according to claim 1 and a pharmaceutically-acceptable carrier.
5. The immunogenic composition of claim 4 , further comprising an adjuvant.
6. The immunogenic composition of claim 5 , where the adjuvant is a water-in-oil emulsion.
7. The immunogenic composition of claim 5 , wherein said fusion protein is emulsified with said adjuvant.
8. A method for increasing antibody production in a subject against an antigenic agent, the method comprising administering a therapeutically effective amount of a fusion protein according to claim 1 to said subject.
9. The method of claim 8 , wherein the subject has a measurable antibody titer against said antigenic agent prior to administration of the fusion protein.
10. The method of claim 8 , wherein the subject is antibody naïve prior to administration of the fusion protein.
11. The method of claim 8 , wherein the fusion protein is administered via injection.
12. The method of claim 8 , wherein the fusion protein is administered subcutaneously or intramuscularly.
13. The method of claim 8 , wherein the fusion protein is co-administered with an adjuvant.
14. The method of claim 13 , further comprising pre-mixing said fusion protein with said adjuvant before said administration.
15. The method of claim 14 , wherein said pre-mixing comprises emulsifying said adjuvant and said fusion protein to yield an emulsion, and administering said emulsion to said subject.
16. A method of inducing an immune response in a subject against viral infection, said method comprising administering a therapeutically effective amount of a fusion protein according to claim 1 to said subject.
17. The method of claim 16 , wherein the subject has a measurable antibody titer against said viral infection prior to administration of the fusion protein.
18. The method of claim 16 , wherein the subject is antibody naïve prior to administration of the fusion protein.
19. The method of claim 16 , wherein the fusion protein is administered via injection.
20. The method of claim 19 , wherein the fusion protein is administered subcutaneously or intramuscularly.
21. The method of claim 16 , wherein the fusion protein is co-administered with an adjuvant.
22. The method of claim 21 , further comprising pre-mixing said fusion protein with said adjuvant before said administration.
23. The method of claim 22 , wherein said pre-mixing comprises emulsifying said adjuvant and said fusion protein to yield an emulsion, and administering said emulsion to said subject.
24. A method of producing a fusion protein according to claim 1 , said method comprising transiently transfecting a nucleic acid encoding for the fusion protein into a HEK293 or CHO cell, wherein the transfected HEK293 or CHO cell expresses the fusion protein, or stably transfecting a nucleic acid encoding for the fusion protein into a CHO cell, wherein the recombinant CHO cell expresses the fusion protein, and wherein the yield of the purified or isolated fusion protein is greater than 20 mg/L in the transfected cells.
25. A cell transfected with a nucleic acid encoding for a fusion protein according to claim 1 .
26. A cDNA encoding a fusion protein according to claim 1 .
27. A fusion protein comprising the sequence of SEQ ID NO: 19 or pharmaceutical composition thereof for use in treatment and/or prophylaxis of a viral infection from SARS-CoV-2 virus.Join the waitlist — get patent alerts
Track US11213581B2 — get alerts on status changes and closely related new filings.
We store only your email — no account needed. See our privacy policy.