US8901279B2ActiveUtilityA1

Humanized antibodies with anti-tumor activity

54
Assignee: TEVA PHARMACEUTICALS AUSTRALIA PTY LTDPriority: Mar 16, 2009Filed: May 21, 2013Granted: Dec 2, 2014
Est. expiryMar 16, 2029(~2.7 yrs left)· nominal 20-yr term from priority
C07K 2317/73C07K 2317/72C07K 2317/732C07K 16/3076C07K 2317/565C07K 2317/567C07K 2317/734A61P 35/00C07K 2317/24C07K 2317/41A61K 2039/505C07K 16/18C07K 16/464G01N 33/57545G01N 33/57535G01N 33/57525G01N 33/5752G01N 33/57419G01N 33/57438G01N 33/57423G01N 33/57449A61K 39/395C07K 16/30
54
PatentIndex Score
0
Cited by
71
References
27
Claims

Abstract

The present invention provides humanised antibodies and binding domains thereof with anti-tumor activity. In particular the humanised antibodies have specific binding to and direct killing of human colon tumor cells and display potent immune-mediated cytotoxic activity against human colon cancer cells in vitro using antibody-dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC) assays and in vivo using mouse tumor models.

Claims

exact text as granted — not AI-modified
The invention claimed is: 
     
       1. A humanized antibody, comprising a VH binding domain having an amino acid sequence selected from the group consisting of the amino acid sequence of residues 1 to 120 of SEQ ID NO: 50, the amino acid sequence of residues 1 to 120 of SEQ ID NO: 38, an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 120 of SEQ ID NO: 50 provided that the residue at position 72 is Arg or Lys and that the VH CDR1 has the amino acid sequence of SEQ ID NO: 96, the VH CDR2 has the amino acid sequence of SEQ ID NO: 98, and the VH CDR3 has the amino acid sequence of SEQ ID NO: 100, and an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 120 of SEQ ID NO: 38 provided that the residue at position 72 is Arg or Lys and that the VH CDR1 has the amino acid sequence of SEQ ID NO: 96, the VH CDR2 has the amino acid sequence of SEQ ID NO: 98, and the VH CDR3 has the amino acid sequence of SEQ ID NO: 100, and a VL binding domain having an amino acid sequence selected from the group consisting of the amino acid sequence of residues 1 to 107 of SEQ ID NO: 7, the amino acid sequence of residues 1 to 107 of SEQ ID NO: 8, an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 107 of SEQ ID NO: 7 provided that the VL CDR1 has the amino acid sequence of SEQ ID NO: 188, the VL CDR2 has the amino acid sequence of SEQ ID NO: 190, and the VL CDR3 has the amino acid sequence of SEQ ID NO: 192, and an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 107 of SEQ ID NO: 8 provided that the VL CDR1 has the amino acid sequence of SEQ ID NO: 188, the VL CDR2 has the amino acid sequence of SEQ ID NO: 190, and the VL CDR3 has the amino acid sequence of SEQ ID NO: 192. 
     
     
       2. The humanized antibody of  claim 1 , in which the amino acid sequence of the VH binding domain comprises the amino acid sequence of residues 1 to 120 of SEQ ID NO: 50 or an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 120 of SEQ ID NO: 50 provided that the residue at position 72 is Arg or Lys and that the VH CDR1 has the amino acid sequence of SEQ ID NO: 96, the VH CDR2 has the amino acid sequence of SEQ ID NO: 98, and the VH CDR3 has the amino acid sequence of SEQ ID NO: 100. 
     
     
       3. The humanized antibody of  claim 2 , in which the amino acid sequence of the VH binding domain CDR2 comprises HIHFSGRPTYNPSLKS (SEQ ID NO: 136). 
     
     
       4. The humanized antibody of  claim 2 , in which the amino acid sequence of the VH binding domain comprises residues 1 to 120 of SEQ ID NO: 50. 
     
     
       5. The humanized antibody of  claim 1 , in which the amino acid sequence of the VH binding domain comprises the amino acid sequence of residues 1 to 120 of SEQ ID NO: 38 or an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 120 of SEQ ID NO: 38 provided that the residue at position 72 is Arg or Lys and that the VH CDR1 has the amino acid sequence of SEQ ID NO: 96, the VH CDR2 has the amino acid sequence of SEQ ID NO: 98, and the VH CDR3 has the amino acid sequence of SEQ ID NO: 100. 
     
     
       6. The humanized antibody of  claim 5 , in which the amino acid sequence of the binding domain VH CDR2 comprises HIHFSGRPTYNPSLKS (SEQ ID NO: 136). 
     
     
       7. The humanized antibody of  claim 5 , in which the amino acid sequence of the VH binding domain comprises residues 1 to 120 of SEQ ID NO: 38. 
     
     
       8. The humanized antibody of  claim 2 , in which the VH binding domain further comprises a constant domain. 
     
     
       9. The humanized antibody of  claim 8 , in which the constant domain has the amino acid sequence: 
       
         
           
                 
                 
               
                   (SEQ ID NO: 52) 
                     
                 
                   ASTKNPDVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV 
                     
                 
                     
                 
                   VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV 
                 
                     
                 
                   TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 
                 
                     
                 
                   APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS 
                 
                     
                 
                   FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK; 
                 
                   or 
                 
                     
                 
                   (SEQ ID NO: 92) 
                     
                 
                   ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV 
                     
                 
                     
                 
                   VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV 
                 
                     
                 
                   TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 
                 
                     
                 
                   APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS 
                 
                     
                 
                   FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK; 
                 
                   or 
                 
                     
                 
                   (SEQ ID NO: 53) 
                     
                 
                   ASTKNPDVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV 
                     
                 
                     
                 
                   VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEV 
                 
                     
                 
                   TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNATYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 
                 
                     
                 
                   APEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG 
                 
                     
                 
                   SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
       10. The humanized antibody of  claim 5 , in which the VH binding domain further comprises a constant domain. 
     
     
       11. The humanized antibody of  claim 10 , in which the constant domain has the amino acid sequence: 
       
         
           
                 
                 
               
                   (SEQ ID NO: 52) 
                     
                 
                   ASTKNPDVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV 
                     
                 
                     
                 
                   VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV 
                 
                     
                 
                   TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 
                 
                     
                 
                   APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS 
                 
                     
                 
                   FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK; 
                 
                   or 
                 
                     
                 
                   (SEQ ID NO: 92) 
                     
                 
                   ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV 
                     
                 
                     
                 
                   VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV 
                 
                     
                 
                   TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 
                 
                     
                 
                   APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS 
                 
                     
                 
                   FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK; 
                 
                   or 
                 
                     
                 
                   (SEQ ID NO: 53) 
                     
                 
                   ASTKNPDVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV 
                     
                 
                     
                 
                   VTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRTPEV 
                 
                     
                 
                   TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNATYRVVSVLTVLHQDWLNGKEYKCKVSNKALP 
                 
                     
                 
                   APEEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG 
                 
                     
                 
                   SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. 
                 
             
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
                
               
            
           
         
       
     
     
       12. The humanized antibody of  claim 2 , in which the amino acid sequence of the VL binding domain comprises the amino acid sequence of residues 1 to 107 of SEQ ID NO: 7 or an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 107 of SEQ ID NO: 7 provided that the VL CDR1 has the amino acid sequence of SEQ ID NO: 188, the VL CDR2 has the amino acid sequence of SEQ ID NO: 190, and the VL CDR3 has the amino acid sequence of SEQ ID NO: 192. 
     
     
       13. The humanized antibody of  claim 12 , in which the amino acid sequence of the VL binding domain comprises residues 1 to 107 of SEQ ID NO: 7. 
     
     
       14. The humanized antibody of  claim 5 , in which the amino acid sequence of the VL binding domain comprises the amino acid sequence of residues 1 to 107 of SEQ ID NO: 8 or an amino acid sequence having at least 95% identity with the amino acid sequence of residues 1 to 107 of SEQ ID NO: 8 provided that the VL CDR1 has the amino acid sequence of SEQ ID NO: 188, the VL CDR2 has the amino acid sequence of SEQ ID NO: 190, and the VL CDR3 has the amino acid sequence of SEQ ID NO: 192. 
     
     
       15. The humanized antibody of  claim 14 , in which the amino acid sequence of the VL binding domain comprises residues 1 to 107 of SEQ ID NO: 8. 
     
     
       16. The humanized antibody of  claim 12 , in which the VL binding domain further comprises a constant domain. 
     
     
       17. The humanized antibody of  claim 16 , in which the constant domain has the amino acid sequence: 
       
         
           
                 
                 
               
                   (SEQ ID NO: 93) 
                     
                 
                   TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 
                     
                 
                     
                 
                   SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC. 
                 
             
                
                
                
                
               
            
           
         
       
     
     
       18. The humanized antibody of  claim 14 , in which the VL binding domain further comprises a constant domain. 
     
     
       19. The humanized antibody of  claim 18 , in which the constant domain has the amino acid sequence: 
       
         
           
                 
                 
               
                   (SEQ ID NO: 93) 
                     
                 
                   TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL 
                     
                 
                     
                 
                   SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC. 
                 
             
                
                
                
                
               
            
           
         
       
     
     
       20. A humanized antibody, comprising a light chain comprising the amino acid sequence of SEQ ID NO: 7 and a heavy chain comprising the amino acid sequence of SEQ ID NO:50. 
     
     
       21. A humanized antibody, comprising a light chain comprising the amino acid sequence of SEQ ID NO: 8 and a heavy chain comprising the amino acid sequence of SEQ ID NO:38. 
     
     
       22. The humanized antibody of  claim 1 , in which the antibody has a reduced level of fucose. 
     
     
       23. The humanized antibody of  claim 20 , in which the antibody has a reduced level of fucose. 
     
     
       24. The humanized antibody of  claim 21 , in which the antibody has a reduced level of fucose. 
     
     
       25. A pharmaceutical preparation, comprising the humanized antibody of  claim 1  and a pharmaceutically acceptable carrier. 
     
     
       26. A pharmaceutical preparation, comprising the humanized antibody of  claim 20  and a pharmaceutically acceptable carrier. 
     
     
       27. A pharmaceutical preparation, comprising the humanized antibody of  claim 21  and a pharmaceutically acceptable carrier.

Cited by (0)

No later patents cite this yet.

References (0)

No backward citations on record.